Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A4U0TL68

Protein Details
Accession A0A4U0TL68    Localization Confidence Medium Confidence Score 11.2
NoLS Segment(s)
PositionSequenceProtein Nature
72-95EKMTTKKVVKKSTSKKRKVEASEDHydrophilic
NLS Segment(s)
PositionSequence
77-89KKVVKKSTSKKRK
Subcellular Location(s) cyto 13.5cyto_nucl 13.5, nucl 12.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR018247  EF_Hand_1_Ca_BS  
PROSITE View protein in PROSITE  
PS00018  EF_HAND_1  
Amino Acid Sequences MGVTNEQFLFSCIDNSNSGTINFQDVADACGITTKGAAYIKFRRMKEKLGTIPNGGEETTGAGDATASGKSEKMTTKKVVKKSTSKKRKVEASEDVDDVDDGVKAIKEEVTEE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.17
2 0.18
3 0.19
4 0.17
5 0.17
6 0.16
7 0.15
8 0.15
9 0.15
10 0.13
11 0.12
12 0.11
13 0.12
14 0.11
15 0.1
16 0.07
17 0.08
18 0.09
19 0.07
20 0.07
21 0.06
22 0.08
23 0.1
24 0.11
25 0.15
26 0.21
27 0.3
28 0.37
29 0.38
30 0.43
31 0.44
32 0.5
33 0.49
34 0.51
35 0.49
36 0.48
37 0.49
38 0.42
39 0.4
40 0.34
41 0.29
42 0.21
43 0.14
44 0.08
45 0.07
46 0.06
47 0.05
48 0.04
49 0.04
50 0.03
51 0.04
52 0.05
53 0.04
54 0.05
55 0.05
56 0.06
57 0.06
58 0.09
59 0.14
60 0.17
61 0.22
62 0.28
63 0.38
64 0.45
65 0.52
66 0.59
67 0.61
68 0.67
69 0.73
70 0.78
71 0.8
72 0.82
73 0.82
74 0.82
75 0.84
76 0.8
77 0.77
78 0.75
79 0.71
80 0.65
81 0.58
82 0.5
83 0.41
84 0.34
85 0.26
86 0.17
87 0.1
88 0.06
89 0.07
90 0.07
91 0.06
92 0.08
93 0.08