Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A4V5N385

Protein Details
Accession A0A4V5N385   
Localization Confidence High
Confidence Score 15.3
NoLS Segment(s)
PositionSequenceProtein Nature
19-41AKDAGVKKHKKSKKAKAVDGESTBasic
80-103KTEAQKRQEERRRKRLEERLTREGBasic
NLS Segment(s)
PositionSequence
15-34KLKGAKDAGVKKHKKSKKAK
86-98RQEERRRKRLEER
Subcellular Location(s) nucl 16, mito_nucl 13.333, mito 9.5, cyto_nucl 9.333
Family & Domain DBs
InterPro View protein in InterPro  
IPR013865  FAM32A  
Pfam View protein in Pfam  
PF08555  FAM32A  
Amino Acid Sequences MPSSDYSNAVGGGLKLKGAKDAGVKKHKKSKKAKAVDGESTEKSSEQTALQVALADEERLDGENGTAREIRETEVKEYGKTEAQKRQEERRRKRLEERLTREGIKTHKERVEELNKYLSNLSEHHDMPRIGPG
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.11
2 0.12
3 0.12
4 0.15
5 0.15
6 0.17
7 0.22
8 0.3
9 0.38
10 0.47
11 0.53
12 0.58
13 0.68
14 0.71
15 0.73
16 0.76
17 0.78
18 0.78
19 0.82
20 0.82
21 0.81
22 0.81
23 0.77
24 0.71
25 0.65
26 0.55
27 0.47
28 0.4
29 0.3
30 0.24
31 0.19
32 0.15
33 0.11
34 0.11
35 0.09
36 0.09
37 0.09
38 0.09
39 0.08
40 0.07
41 0.07
42 0.06
43 0.05
44 0.05
45 0.05
46 0.05
47 0.05
48 0.04
49 0.04
50 0.07
51 0.08
52 0.09
53 0.1
54 0.09
55 0.1
56 0.1
57 0.11
58 0.13
59 0.14
60 0.15
61 0.2
62 0.2
63 0.2
64 0.2
65 0.21
66 0.21
67 0.23
68 0.27
69 0.28
70 0.35
71 0.42
72 0.45
73 0.54
74 0.6
75 0.67
76 0.72
77 0.76
78 0.78
79 0.77
80 0.83
81 0.82
82 0.83
83 0.83
84 0.82
85 0.78
86 0.74
87 0.69
88 0.6
89 0.54
90 0.48
91 0.46
92 0.41
93 0.42
94 0.41
95 0.41
96 0.43
97 0.48
98 0.53
99 0.49
100 0.48
101 0.49
102 0.45
103 0.45
104 0.43
105 0.35
106 0.28
107 0.25
108 0.26
109 0.23
110 0.24
111 0.25
112 0.3
113 0.28