Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A4V5N6S3

Protein Details
Accession A0A4V5N6S3    Localization Confidence Low Confidence Score 5.8
NoLS Segment(s)
PositionSequenceProtein Nature
80-100PSAARPQYKRWHRPRSTKIMTHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 19.5, cyto_mito 12, cyto 3.5, nucl 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR012677  Nucleotide-bd_a/b_plait_sf  
IPR012678  Ribosomal_L23/L15e_core_dom_sf  
IPR013025  Ribosomal_L25/23  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Amino Acid Sequences MTTAVPPSFRLGLKKIYLPDFTVALKRTPFLPPTQATFTVPLWFSKLDLRDYLYNVYKLPISPSIRSYVRQSRLRQGADPSAARPQYKRWHRPRSTKIMTVEMGQGFVWPTGPRTEEDFKSWNKKELKIAKEENAAMQERAGPGGDAVGVGEERRAAMKEQAKALLEGRERWRSGGKEGQGIMFGR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.39
2 0.39
3 0.4
4 0.4
5 0.38
6 0.36
7 0.31
8 0.3
9 0.3
10 0.27
11 0.26
12 0.24
13 0.23
14 0.23
15 0.25
16 0.26
17 0.24
18 0.29
19 0.28
20 0.33
21 0.37
22 0.37
23 0.34
24 0.34
25 0.32
26 0.28
27 0.27
28 0.22
29 0.19
30 0.18
31 0.17
32 0.19
33 0.2
34 0.19
35 0.19
36 0.22
37 0.22
38 0.24
39 0.27
40 0.26
41 0.24
42 0.22
43 0.22
44 0.19
45 0.17
46 0.18
47 0.2
48 0.21
49 0.22
50 0.23
51 0.27
52 0.28
53 0.3
54 0.33
55 0.35
56 0.4
57 0.45
58 0.47
59 0.5
60 0.56
61 0.56
62 0.51
63 0.46
64 0.42
65 0.38
66 0.35
67 0.28
68 0.26
69 0.26
70 0.25
71 0.22
72 0.24
73 0.31
74 0.4
75 0.49
76 0.53
77 0.63
78 0.7
79 0.79
80 0.81
81 0.82
82 0.77
83 0.72
84 0.64
85 0.57
86 0.5
87 0.41
88 0.36
89 0.25
90 0.21
91 0.15
92 0.13
93 0.09
94 0.09
95 0.09
96 0.06
97 0.07
98 0.08
99 0.09
100 0.1
101 0.15
102 0.2
103 0.2
104 0.24
105 0.27
106 0.3
107 0.38
108 0.39
109 0.41
110 0.4
111 0.42
112 0.47
113 0.52
114 0.52
115 0.51
116 0.54
117 0.51
118 0.51
119 0.49
120 0.41
121 0.37
122 0.34
123 0.26
124 0.21
125 0.19
126 0.15
127 0.15
128 0.13
129 0.09
130 0.07
131 0.07
132 0.07
133 0.05
134 0.04
135 0.05
136 0.04
137 0.04
138 0.05
139 0.05
140 0.05
141 0.07
142 0.08
143 0.09
144 0.17
145 0.23
146 0.27
147 0.3
148 0.34
149 0.34
150 0.34
151 0.34
152 0.34
153 0.31
154 0.33
155 0.37
156 0.41
157 0.4
158 0.42
159 0.47
160 0.42
161 0.46
162 0.48
163 0.45
164 0.43
165 0.44
166 0.42