Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A4U0TUQ2

Protein Details
Accession A0A4U0TUQ2    Localization Confidence Medium Confidence Score 12.1
NoLS Segment(s)
PositionSequenceProtein Nature
149-201TTTPLVAKRPRGRPKKVKDLGQRRECLTMAKRPPGKPKKMVEKRGPGRPRKSVBasic
NLS Segment(s)
PositionSequence
156-201KRPRGRPKKVKDLGQRRECLTMAKRPPGKPKKMVEKRGPGRPRKSV
215-224AKRGPGRPRK
Subcellular Location(s) mito 10.5, mito_nucl 9.5, cyto 9, nucl 7.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR017956  AT_hook_DNA-bd_motif  
Gene Ontology GO:0003677  F:DNA binding  
Amino Acid Sequences MTDIQGLREHILARNRASRSQQSPLRQAIHPPHPHQSLAYTAVITSSEGKIRLKSAEAATPVAALVALLDTTARILDDMFVKGGERVYEGETLQVCADGSRVAREVEGAPPSPVDDEFEENVDAEVEESLDVNVTDASQPQPQAQQNGTTTPLVAKRPRGRPKKVKDLGQRRECLTMAKRPPGKPKKMVEKRGPGRPRKSVVPAEAAVGETAAVAKRGPGRPRKIAAEHAVSLQQSEQWM
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.4
2 0.42
3 0.45
4 0.51
5 0.54
6 0.53
7 0.58
8 0.6
9 0.6
10 0.64
11 0.66
12 0.63
13 0.56
14 0.57
15 0.56
16 0.59
17 0.59
18 0.56
19 0.57
20 0.55
21 0.55
22 0.48
23 0.41
24 0.35
25 0.31
26 0.27
27 0.19
28 0.16
29 0.16
30 0.15
31 0.14
32 0.13
33 0.1
34 0.12
35 0.14
36 0.15
37 0.17
38 0.18
39 0.19
40 0.19
41 0.21
42 0.21
43 0.23
44 0.24
45 0.24
46 0.22
47 0.2
48 0.18
49 0.13
50 0.11
51 0.06
52 0.04
53 0.03
54 0.03
55 0.02
56 0.03
57 0.03
58 0.03
59 0.03
60 0.03
61 0.03
62 0.03
63 0.05
64 0.06
65 0.07
66 0.07
67 0.07
68 0.08
69 0.08
70 0.09
71 0.08
72 0.07
73 0.08
74 0.09
75 0.11
76 0.1
77 0.12
78 0.12
79 0.12
80 0.11
81 0.1
82 0.08
83 0.07
84 0.07
85 0.06
86 0.06
87 0.06
88 0.07
89 0.07
90 0.07
91 0.08
92 0.09
93 0.1
94 0.12
95 0.11
96 0.1
97 0.1
98 0.11
99 0.1
100 0.09
101 0.08
102 0.08
103 0.09
104 0.1
105 0.11
106 0.1
107 0.1
108 0.1
109 0.08
110 0.07
111 0.05
112 0.04
113 0.03
114 0.03
115 0.03
116 0.03
117 0.03
118 0.03
119 0.03
120 0.03
121 0.03
122 0.04
123 0.04
124 0.06
125 0.08
126 0.09
127 0.09
128 0.15
129 0.16
130 0.19
131 0.19
132 0.22
133 0.21
134 0.22
135 0.23
136 0.18
137 0.17
138 0.16
139 0.18
140 0.19
141 0.21
142 0.28
143 0.34
144 0.44
145 0.55
146 0.62
147 0.69
148 0.75
149 0.81
150 0.84
151 0.82
152 0.81
153 0.82
154 0.84
155 0.84
156 0.82
157 0.77
158 0.68
159 0.64
160 0.55
161 0.51
162 0.44
163 0.43
164 0.4
165 0.45
166 0.5
167 0.52
168 0.63
169 0.67
170 0.71
171 0.7
172 0.73
173 0.76
174 0.79
175 0.84
176 0.83
177 0.84
178 0.83
179 0.84
180 0.85
181 0.83
182 0.81
183 0.79
184 0.74
185 0.7
186 0.7
187 0.67
188 0.61
189 0.57
190 0.5
191 0.43
192 0.39
193 0.33
194 0.25
195 0.17
196 0.13
197 0.07
198 0.08
199 0.06
200 0.06
201 0.06
202 0.09
203 0.16
204 0.23
205 0.32
206 0.41
207 0.49
208 0.57
209 0.63
210 0.68
211 0.66
212 0.67
213 0.66
214 0.62
215 0.56
216 0.5
217 0.47
218 0.39
219 0.35
220 0.27