Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A4U0TSQ2

Protein Details
Accession A0A4U0TSQ2    Localization Confidence Medium Confidence Score 13.9
NoLS Segment(s)
PositionSequenceProtein Nature
208-233DEEQVPKTKARSRKGKKKAEDETADAHydrophilic
NLS Segment(s)
PositionSequence
133-145REVKKVGTKKRKK
160-169KKKAASRKGS
214-225KTKARSRKGKKK
Subcellular Location(s) cyto 11, cyto_nucl 10.333, cyto_mito 9.333, nucl 8.5, mito 6.5
Family & Domain DBs
Amino Acid Sequences MTSANLTSRQIQLLSAVCEVMKANIEWTKVAKIANMKTAKYARDSWTTVREKLQTSQALTPRQFELLCAVGAIMKADIDWARVAEQAEFKSGKYARDTWAGVRKKLVAASGAEDTAGEGDDVDAGKEDAAPGREVKKVGTKKRKKAADDDDDDDGDVLPKKKAASRKGSKVKVETAVEEDEEEPVPEKRSTVGNVGKRIKVETADEEDEEQVPKTKARSRKGKKKAEDETADAAEAIINPDLEDGLLCLT
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.23
2 0.2
3 0.18
4 0.16
5 0.16
6 0.16
7 0.14
8 0.13
9 0.1
10 0.14
11 0.17
12 0.18
13 0.19
14 0.21
15 0.22
16 0.22
17 0.22
18 0.22
19 0.26
20 0.28
21 0.36
22 0.38
23 0.35
24 0.4
25 0.44
26 0.43
27 0.4
28 0.42
29 0.37
30 0.4
31 0.43
32 0.4
33 0.45
34 0.48
35 0.46
36 0.45
37 0.45
38 0.41
39 0.41
40 0.44
41 0.38
42 0.38
43 0.42
44 0.43
45 0.46
46 0.44
47 0.43
48 0.36
49 0.34
50 0.31
51 0.24
52 0.21
53 0.16
54 0.15
55 0.12
56 0.11
57 0.09
58 0.09
59 0.09
60 0.06
61 0.04
62 0.04
63 0.06
64 0.06
65 0.06
66 0.07
67 0.07
68 0.08
69 0.09
70 0.1
71 0.1
72 0.13
73 0.12
74 0.15
75 0.15
76 0.15
77 0.2
78 0.21
79 0.21
80 0.22
81 0.24
82 0.23
83 0.27
84 0.28
85 0.26
86 0.34
87 0.35
88 0.32
89 0.31
90 0.3
91 0.26
92 0.26
93 0.22
94 0.15
95 0.12
96 0.14
97 0.13
98 0.12
99 0.1
100 0.09
101 0.08
102 0.07
103 0.06
104 0.04
105 0.03
106 0.03
107 0.03
108 0.03
109 0.03
110 0.03
111 0.03
112 0.03
113 0.03
114 0.04
115 0.04
116 0.05
117 0.06
118 0.07
119 0.1
120 0.11
121 0.12
122 0.13
123 0.2
124 0.27
125 0.37
126 0.47
127 0.54
128 0.61
129 0.7
130 0.76
131 0.7
132 0.72
133 0.71
134 0.69
135 0.65
136 0.59
137 0.52
138 0.45
139 0.42
140 0.32
141 0.23
142 0.15
143 0.13
144 0.11
145 0.09
146 0.1
147 0.12
148 0.15
149 0.23
150 0.3
151 0.38
152 0.45
153 0.56
154 0.64
155 0.7
156 0.71
157 0.68
158 0.64
159 0.6
160 0.53
161 0.44
162 0.37
163 0.32
164 0.27
165 0.24
166 0.2
167 0.15
168 0.13
169 0.12
170 0.1
171 0.1
172 0.13
173 0.12
174 0.12
175 0.13
176 0.16
177 0.18
178 0.24
179 0.31
180 0.33
181 0.42
182 0.47
183 0.47
184 0.45
185 0.45
186 0.39
187 0.33
188 0.31
189 0.27
190 0.29
191 0.29
192 0.29
193 0.28
194 0.27
195 0.26
196 0.24
197 0.19
198 0.17
199 0.16
200 0.17
201 0.21
202 0.27
203 0.35
204 0.44
205 0.55
206 0.62
207 0.72
208 0.8
209 0.86
210 0.88
211 0.9
212 0.89
213 0.88
214 0.82
215 0.77
216 0.72
217 0.62
218 0.53
219 0.42
220 0.33
221 0.24
222 0.18
223 0.15
224 0.1
225 0.08
226 0.08
227 0.08
228 0.08
229 0.08
230 0.07