Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A4U0TRP3

Protein Details
Accession A0A4U0TRP3   
Localization Confidence Medium
Confidence Score 12.8
NoLS Segment(s)
PositionSequenceProtein Nature
173-198YFSSTAPRSRSPRRRRRTPPSEEELSHydrophilic
NLS Segment(s)
PositionSequence
125-143GQRRRASPRRSGGGYGSRS
180-189RSRSPRRRRR
Subcellular Location(s) nucl 8.5, plas 7, cyto_nucl 6.5, mito 5, cyto 3.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR023395  Mt_carrier_dom_sf  
Gene Ontology GO:0005743  C:mitochondrial inner membrane  
Amino Acid Sequences MDTNPGSGTFLMTTAKDRSPNPLRPYYVPPSVGPAPSSTTAQSPHTARPHPAGARGASGSIAGDLFPEFDLDFKTSAGEAWSASRQLFDALLYKYLSVLLAQPFDVAKTVLQLSLPPSADAGVKGQRRRASPRRSGGGYGSRSRRDRPYDDAEGDEGAEDEETGDESDDVPDYFSSTAPRSRSPRRRRRTPPSEEELSPTPTPSKHRRDQDATHDYRLYLKRQDSLLHAMSALYNTSGGVGLWRSTNCTFLYSVLLRTTDTFLRSLLLALLGLPEIPGPDPSGLGSALNVQGGMGLSGLDLSDSPNAFGSLVVVGLSSCIAGLLLSPLDQIRTRLIATPTSHQPRGLLQNLRHLPSLLAPNSLWLPTALAHSIPQVFSASMPLMLRRQLKFSPEATPGLWSFSAFCTCLTDLFIRLPLETIERRAQIHALKRADPLMPTIIEPAPYAGVGGTVYSILYQEGETRIKDPRTGMIRIKRGQGVAGLVRGWRVGFWGLVGVWGAGAMGPGEGKGRGEF
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.2
2 0.24
3 0.27
4 0.27
5 0.36
6 0.44
7 0.52
8 0.56
9 0.59
10 0.6
11 0.6
12 0.68
13 0.65
14 0.62
15 0.56
16 0.49
17 0.47
18 0.46
19 0.43
20 0.36
21 0.3
22 0.28
23 0.28
24 0.29
25 0.23
26 0.22
27 0.24
28 0.26
29 0.3
30 0.28
31 0.34
32 0.4
33 0.42
34 0.43
35 0.45
36 0.5
37 0.47
38 0.49
39 0.46
40 0.39
41 0.39
42 0.36
43 0.31
44 0.24
45 0.21
46 0.16
47 0.12
48 0.1
49 0.07
50 0.06
51 0.06
52 0.07
53 0.06
54 0.07
55 0.06
56 0.07
57 0.1
58 0.11
59 0.11
60 0.1
61 0.11
62 0.1
63 0.11
64 0.12
65 0.1
66 0.09
67 0.12
68 0.14
69 0.14
70 0.14
71 0.14
72 0.13
73 0.14
74 0.13
75 0.11
76 0.14
77 0.14
78 0.16
79 0.16
80 0.16
81 0.15
82 0.15
83 0.14
84 0.09
85 0.12
86 0.12
87 0.12
88 0.12
89 0.13
90 0.13
91 0.13
92 0.13
93 0.1
94 0.08
95 0.09
96 0.1
97 0.1
98 0.1
99 0.11
100 0.13
101 0.17
102 0.18
103 0.15
104 0.15
105 0.15
106 0.16
107 0.15
108 0.16
109 0.18
110 0.23
111 0.26
112 0.32
113 0.35
114 0.4
115 0.49
116 0.56
117 0.59
118 0.63
119 0.68
120 0.69
121 0.67
122 0.64
123 0.6
124 0.58
125 0.54
126 0.52
127 0.5
128 0.5
129 0.5
130 0.52
131 0.55
132 0.53
133 0.52
134 0.52
135 0.53
136 0.53
137 0.51
138 0.49
139 0.41
140 0.34
141 0.3
142 0.23
143 0.15
144 0.08
145 0.07
146 0.05
147 0.04
148 0.04
149 0.04
150 0.04
151 0.05
152 0.05
153 0.05
154 0.06
155 0.06
156 0.06
157 0.06
158 0.06
159 0.07
160 0.07
161 0.07
162 0.1
163 0.11
164 0.16
165 0.17
166 0.23
167 0.29
168 0.39
169 0.49
170 0.58
171 0.67
172 0.73
173 0.81
174 0.86
175 0.9
176 0.9
177 0.89
178 0.86
179 0.83
180 0.78
181 0.68
182 0.62
183 0.53
184 0.47
185 0.38
186 0.3
187 0.24
188 0.21
189 0.27
190 0.32
191 0.38
192 0.4
193 0.47
194 0.54
195 0.59
196 0.62
197 0.66
198 0.67
199 0.62
200 0.57
201 0.51
202 0.43
203 0.44
204 0.41
205 0.34
206 0.3
207 0.28
208 0.28
209 0.29
210 0.3
211 0.27
212 0.29
213 0.27
214 0.22
215 0.2
216 0.17
217 0.16
218 0.14
219 0.11
220 0.05
221 0.04
222 0.04
223 0.04
224 0.04
225 0.04
226 0.04
227 0.04
228 0.05
229 0.06
230 0.06
231 0.1
232 0.1
233 0.12
234 0.12
235 0.13
236 0.13
237 0.12
238 0.16
239 0.13
240 0.13
241 0.12
242 0.12
243 0.11
244 0.11
245 0.13
246 0.11
247 0.11
248 0.1
249 0.1
250 0.1
251 0.1
252 0.09
253 0.07
254 0.06
255 0.04
256 0.04
257 0.04
258 0.03
259 0.03
260 0.03
261 0.03
262 0.03
263 0.04
264 0.04
265 0.05
266 0.05
267 0.05
268 0.05
269 0.06
270 0.06
271 0.06
272 0.06
273 0.06
274 0.06
275 0.06
276 0.06
277 0.05
278 0.05
279 0.05
280 0.05
281 0.03
282 0.03
283 0.03
284 0.03
285 0.03
286 0.03
287 0.03
288 0.04
289 0.06
290 0.06
291 0.06
292 0.07
293 0.07
294 0.07
295 0.07
296 0.07
297 0.05
298 0.05
299 0.04
300 0.04
301 0.04
302 0.03
303 0.04
304 0.03
305 0.03
306 0.02
307 0.02
308 0.02
309 0.03
310 0.03
311 0.03
312 0.03
313 0.04
314 0.04
315 0.06
316 0.07
317 0.08
318 0.09
319 0.1
320 0.11
321 0.15
322 0.16
323 0.2
324 0.22
325 0.25
326 0.32
327 0.37
328 0.37
329 0.33
330 0.33
331 0.32
332 0.37
333 0.39
334 0.36
335 0.32
336 0.41
337 0.44
338 0.45
339 0.41
340 0.35
341 0.28
342 0.26
343 0.31
344 0.22
345 0.21
346 0.18
347 0.19
348 0.2
349 0.19
350 0.16
351 0.09
352 0.09
353 0.08
354 0.1
355 0.09
356 0.09
357 0.09
358 0.11
359 0.12
360 0.11
361 0.11
362 0.1
363 0.1
364 0.1
365 0.11
366 0.1
367 0.1
368 0.1
369 0.12
370 0.12
371 0.17
372 0.23
373 0.22
374 0.27
375 0.28
376 0.31
377 0.34
378 0.34
379 0.35
380 0.32
381 0.33
382 0.29
383 0.3
384 0.26
385 0.25
386 0.23
387 0.17
388 0.15
389 0.15
390 0.17
391 0.14
392 0.14
393 0.14
394 0.15
395 0.15
396 0.17
397 0.16
398 0.15
399 0.16
400 0.2
401 0.16
402 0.16
403 0.16
404 0.14
405 0.19
406 0.19
407 0.22
408 0.24
409 0.25
410 0.27
411 0.27
412 0.31
413 0.32
414 0.38
415 0.42
416 0.41
417 0.41
418 0.42
419 0.43
420 0.4
421 0.35
422 0.3
423 0.25
424 0.22
425 0.2
426 0.22
427 0.2
428 0.19
429 0.18
430 0.16
431 0.13
432 0.12
433 0.11
434 0.08
435 0.07
436 0.06
437 0.06
438 0.05
439 0.05
440 0.05
441 0.05
442 0.05
443 0.05
444 0.06
445 0.06
446 0.08
447 0.13
448 0.16
449 0.17
450 0.19
451 0.25
452 0.27
453 0.3
454 0.29
455 0.33
456 0.36
457 0.41
458 0.48
459 0.5
460 0.57
461 0.59
462 0.63
463 0.59
464 0.54
465 0.49
466 0.43
467 0.39
468 0.32
469 0.3
470 0.25
471 0.21
472 0.21
473 0.21
474 0.18
475 0.13
476 0.12
477 0.12
478 0.11
479 0.11
480 0.12
481 0.11
482 0.12
483 0.12
484 0.1
485 0.08
486 0.07
487 0.07
488 0.05
489 0.05
490 0.04
491 0.04
492 0.04
493 0.05
494 0.07
495 0.08