Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A4U0U5C5

Protein Details
Accession A0A4U0U5C5    Localization Confidence Low Confidence Score 9.7
NoLS Segment(s)
PositionSequenceProtein Nature
97-126MATKIEKASRQQRKQRKNRSKEFRGTAKTKHydrophilic
NLS Segment(s)
PositionSequence
103-134KASRQQRKQRKNRSKEFRGTAKTKGASKDKKK
Subcellular Location(s) mito 16.5, mito_nucl 12.333, nucl 7, cyto_nucl 5.833
Family & Domain DBs
InterPro View protein in InterPro  
IPR012678  Ribosomal_L23/L15e_core_dom_sf  
IPR001976  Ribosomal_S24e  
IPR018098  Ribosomal_S24e_CS  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF01282  Ribosomal_S24e  
PROSITE View protein in PROSITE  
PS00529  RIBOSOMAL_S24E  
Amino Acid Sequences MSEGQVTLRTRKFIRNPLLGRKQMVVDVLHPSRPNVSKDELRSKLSELYKSNKDQVSCFGFRTRYGGGKSTGFALIYDSNDAMKQFEPHYRLVRYGMATKIEKASRQQRKQRKNRSKEFRGTAKTKGASKDKKK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.59
2 0.62
3 0.65
4 0.71
5 0.78
6 0.72
7 0.66
8 0.59
9 0.51
10 0.42
11 0.38
12 0.29
13 0.21
14 0.25
15 0.24
16 0.25
17 0.24
18 0.23
19 0.26
20 0.29
21 0.3
22 0.26
23 0.3
24 0.32
25 0.38
26 0.47
27 0.45
28 0.44
29 0.43
30 0.41
31 0.42
32 0.4
33 0.39
34 0.32
35 0.35
36 0.38
37 0.4
38 0.43
39 0.39
40 0.36
41 0.32
42 0.34
43 0.34
44 0.29
45 0.28
46 0.26
47 0.24
48 0.24
49 0.26
50 0.23
51 0.2
52 0.2
53 0.21
54 0.19
55 0.19
56 0.19
57 0.17
58 0.16
59 0.12
60 0.1
61 0.1
62 0.1
63 0.09
64 0.1
65 0.09
66 0.08
67 0.09
68 0.09
69 0.08
70 0.08
71 0.09
72 0.1
73 0.15
74 0.17
75 0.21
76 0.26
77 0.26
78 0.27
79 0.27
80 0.28
81 0.25
82 0.26
83 0.25
84 0.25
85 0.25
86 0.25
87 0.29
88 0.28
89 0.28
90 0.32
91 0.4
92 0.46
93 0.55
94 0.64
95 0.69
96 0.78
97 0.87
98 0.91
99 0.92
100 0.92
101 0.93
102 0.93
103 0.93
104 0.92
105 0.89
106 0.88
107 0.86
108 0.79
109 0.74
110 0.72
111 0.67
112 0.63
113 0.62
114 0.63