Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A4U0TP10

Protein Details
Accession A0A4U0TP10    Localization Confidence Medium Confidence Score 10.8
NoLS Segment(s)
PositionSequenceProtein Nature
1-29MAPAAAGAKKQKKKWSKGKVKDKAQHAVIHydrophilic
NLS Segment(s)
PositionSequence
7-23GAKKQKKKWSKGKVKDK
Subcellular Location(s) nucl 10.5, mito_nucl 8.5, cyto 8, mito 5.5, cyto_pero 5.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR004977  Ribosomal_S25  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
Pfam View protein in Pfam  
PF03297  Ribosomal_S25  
Amino Acid Sequences MAPAAAGAKKQKKKWSKGKVKDKAQHAVILDKPTSEKLNKDVQSYRLITVAVLVDRLKINGSLARKALADLEQRGVIKKVVAHNALNVYTREVGGSD
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.81
2 0.83
3 0.84
4 0.88
5 0.92
6 0.92
7 0.92
8 0.89
9 0.85
10 0.82
11 0.72
12 0.65
13 0.55
14 0.5
15 0.42
16 0.38
17 0.31
18 0.24
19 0.23
20 0.21
21 0.23
22 0.19
23 0.18
24 0.18
25 0.27
26 0.28
27 0.31
28 0.32
29 0.32
30 0.35
31 0.35
32 0.32
33 0.23
34 0.22
35 0.17
36 0.15
37 0.13
38 0.08
39 0.07
40 0.06
41 0.07
42 0.07
43 0.07
44 0.07
45 0.07
46 0.08
47 0.1
48 0.13
49 0.14
50 0.15
51 0.16
52 0.15
53 0.16
54 0.16
55 0.17
56 0.18
57 0.17
58 0.19
59 0.2
60 0.21
61 0.22
62 0.22
63 0.18
64 0.16
65 0.18
66 0.22
67 0.26
68 0.3
69 0.29
70 0.31
71 0.34
72 0.35
73 0.34
74 0.28
75 0.25
76 0.22
77 0.22