Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A4U0TZP9

Protein Details
Accession A0A4U0TZP9    Localization Confidence Low Confidence Score 9.5
NoLS Segment(s)
PositionSequenceProtein Nature
343-365HAPATDKSRKRARPRGGRRSDLQBasic
NLS Segment(s)
PositionSequence
340-361PSGHAPATDKSRKRARPRGGRR
Subcellular Location(s) mito 16, cyto 6, nucl 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR036915  Cyclin-like_sf  
IPR013922  Cyclin_PHO80-like  
Gene Ontology GO:0019901  F:protein kinase binding  
GO:0000079  P:regulation of cyclin-dependent protein serine/threonine kinase activity  
Pfam View protein in Pfam  
PF08613  Cyclin  
CDD cd20557  CYCLIN_ScPCL1-like  
Amino Acid Sequences MVEVIWPLSVAPCNNQRVSGRSVLPLRTYIEETLRRSRTSYSTLQVALYYLVLIKPFVPRSDFTMEQTTDCPASHALMCGRRMFLAALILASKYLQDRNYSAKAWSKMSGLKVDEINTNERTFLNKICWKLHIAEPVFKRWTDVVLRYTPSLHPPSPGQGMGITWKSLIPVLTPELDKVPLSPQSKPEPASRCPASYGCASPTTPTTPTPPRSVPNPMQLASTSQQTTPTPHNLLPRFLEPKPDLAPPTPALARMGPLPTPNMTPSSVASNTPAATCRNVPRLRGFPQPVKEEKVGIEIKPTVLGDDTEMVSTSPDTIDFAISDKALHAPHRHSKHAPQPSGHAPATDKSRKRARPRGGRRSDLQEEVRMLLEEELDAMDVDYNDHEDEVSPSPAATYASSMLSGSTSVVNSSKEAQAPPSLSRQTSRVPVLKNEGKKRTCCAAASSSSSSSMSISPSPLWGEVV
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.33
2 0.38
3 0.39
4 0.4
5 0.45
6 0.45
7 0.4
8 0.41
9 0.45
10 0.43
11 0.43
12 0.41
13 0.38
14 0.35
15 0.36
16 0.32
17 0.35
18 0.38
19 0.41
20 0.48
21 0.49
22 0.46
23 0.45
24 0.47
25 0.44
26 0.44
27 0.45
28 0.39
29 0.4
30 0.4
31 0.38
32 0.34
33 0.29
34 0.23
35 0.17
36 0.13
37 0.09
38 0.09
39 0.08
40 0.09
41 0.09
42 0.15
43 0.17
44 0.19
45 0.22
46 0.22
47 0.28
48 0.35
49 0.35
50 0.33
51 0.38
52 0.37
53 0.35
54 0.35
55 0.31
56 0.25
57 0.24
58 0.21
59 0.14
60 0.16
61 0.15
62 0.17
63 0.19
64 0.23
65 0.26
66 0.26
67 0.27
68 0.24
69 0.25
70 0.22
71 0.18
72 0.15
73 0.12
74 0.11
75 0.1
76 0.1
77 0.09
78 0.09
79 0.09
80 0.09
81 0.12
82 0.13
83 0.16
84 0.19
85 0.25
86 0.3
87 0.3
88 0.31
89 0.35
90 0.37
91 0.36
92 0.35
93 0.32
94 0.32
95 0.34
96 0.36
97 0.3
98 0.3
99 0.29
100 0.29
101 0.3
102 0.28
103 0.29
104 0.26
105 0.25
106 0.23
107 0.21
108 0.23
109 0.21
110 0.21
111 0.25
112 0.27
113 0.3
114 0.31
115 0.33
116 0.32
117 0.33
118 0.35
119 0.36
120 0.34
121 0.37
122 0.37
123 0.42
124 0.41
125 0.38
126 0.35
127 0.27
128 0.29
129 0.26
130 0.28
131 0.26
132 0.27
133 0.29
134 0.28
135 0.29
136 0.26
137 0.28
138 0.29
139 0.25
140 0.23
141 0.23
142 0.26
143 0.27
144 0.26
145 0.2
146 0.15
147 0.15
148 0.17
149 0.16
150 0.13
151 0.1
152 0.1
153 0.1
154 0.11
155 0.1
156 0.07
157 0.08
158 0.1
159 0.11
160 0.11
161 0.12
162 0.12
163 0.13
164 0.12
165 0.11
166 0.12
167 0.17
168 0.19
169 0.21
170 0.24
171 0.29
172 0.32
173 0.34
174 0.38
175 0.36
176 0.37
177 0.42
178 0.39
179 0.34
180 0.34
181 0.32
182 0.27
183 0.24
184 0.23
185 0.17
186 0.18
187 0.17
188 0.15
189 0.17
190 0.17
191 0.16
192 0.16
193 0.19
194 0.24
195 0.26
196 0.3
197 0.3
198 0.3
199 0.32
200 0.38
201 0.37
202 0.37
203 0.38
204 0.34
205 0.32
206 0.3
207 0.3
208 0.24
209 0.23
210 0.16
211 0.13
212 0.15
213 0.15
214 0.17
215 0.17
216 0.2
217 0.2
218 0.21
219 0.28
220 0.27
221 0.28
222 0.27
223 0.28
224 0.29
225 0.27
226 0.3
227 0.24
228 0.26
229 0.26
230 0.26
231 0.24
232 0.2
233 0.23
234 0.18
235 0.2
236 0.17
237 0.15
238 0.15
239 0.13
240 0.13
241 0.11
242 0.12
243 0.1
244 0.1
245 0.11
246 0.11
247 0.12
248 0.12
249 0.13
250 0.12
251 0.12
252 0.12
253 0.16
254 0.15
255 0.15
256 0.15
257 0.14
258 0.14
259 0.14
260 0.15
261 0.12
262 0.13
263 0.15
264 0.18
265 0.26
266 0.27
267 0.29
268 0.33
269 0.37
270 0.39
271 0.45
272 0.46
273 0.43
274 0.47
275 0.51
276 0.48
277 0.48
278 0.45
279 0.38
280 0.33
281 0.33
282 0.3
283 0.24
284 0.24
285 0.19
286 0.19
287 0.19
288 0.18
289 0.12
290 0.1
291 0.1
292 0.08
293 0.09
294 0.09
295 0.08
296 0.08
297 0.08
298 0.07
299 0.07
300 0.07
301 0.05
302 0.05
303 0.06
304 0.06
305 0.06
306 0.06
307 0.08
308 0.08
309 0.08
310 0.08
311 0.08
312 0.1
313 0.11
314 0.14
315 0.16
316 0.22
317 0.31
318 0.36
319 0.41
320 0.43
321 0.49
322 0.55
323 0.62
324 0.6
325 0.52
326 0.53
327 0.54
328 0.56
329 0.49
330 0.4
331 0.32
332 0.32
333 0.39
334 0.42
335 0.39
336 0.4
337 0.5
338 0.58
339 0.66
340 0.73
341 0.74
342 0.77
343 0.85
344 0.89
345 0.88
346 0.85
347 0.8
348 0.78
349 0.73
350 0.68
351 0.6
352 0.53
353 0.45
354 0.4
355 0.36
356 0.27
357 0.23
358 0.16
359 0.13
360 0.09
361 0.08
362 0.07
363 0.06
364 0.06
365 0.05
366 0.06
367 0.06
368 0.06
369 0.06
370 0.08
371 0.08
372 0.08
373 0.08
374 0.07
375 0.11
376 0.13
377 0.14
378 0.13
379 0.12
380 0.12
381 0.13
382 0.14
383 0.11
384 0.1
385 0.1
386 0.11
387 0.12
388 0.11
389 0.11
390 0.1
391 0.1
392 0.09
393 0.09
394 0.08
395 0.09
396 0.11
397 0.12
398 0.14
399 0.17
400 0.19
401 0.21
402 0.22
403 0.23
404 0.26
405 0.28
406 0.3
407 0.35
408 0.35
409 0.34
410 0.36
411 0.37
412 0.37
413 0.41
414 0.45
415 0.44
416 0.43
417 0.47
418 0.55
419 0.59
420 0.63
421 0.66
422 0.69
423 0.69
424 0.7
425 0.7
426 0.68
427 0.64
428 0.57
429 0.53
430 0.5
431 0.48
432 0.51
433 0.49
434 0.42
435 0.4
436 0.38
437 0.32
438 0.27
439 0.23
440 0.2
441 0.18
442 0.19
443 0.18
444 0.2
445 0.21