Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A4U0TUR1

Protein Details
Accession A0A4U0TUR1   
Localization Confidence Medium
Confidence Score 13.3
NoLS Segment(s)
PositionSequenceProtein Nature
99-126KEDASRVSERQKKKQRHFPQRVYAVKAQHydrophilic
NLS Segment(s)
PositionSequence
106-113SERQKKKQ
Subcellular Location(s) nucl 18.5, cyto_nucl 11.5, mito 5
Family & Domain DBs
InterPro View protein in InterPro  
IPR001854  Ribosomal_L29/L35  
IPR036049  Ribosomal_L29/L35_sf  
IPR045059  RL35  
Gene Ontology GO:0022625  C:cytosolic large ribosomal subunit  
GO:0003735  F:structural constituent of ribosome  
GO:0000463  P:maturation of LSU-rRNA from tricistronic rRNA transcript (SSU-rRNA, 5.8S rRNA, LSU-rRNA)  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF00831  Ribosomal_L29  
CDD cd00427  Ribosomal_L29_HIP  
Amino Acid Sequences MSSGKVKASQLWGKNKEELRKQLDELKQELVQLRTQKIAGGAQSKLNKIHDVRKSIARVLTVINQTQRHQLRLFYEKKKYLPLDLRPKQTRAMRRALSKEDASRVSERQKKKQRHFPQRVYAVKAQ
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.61
2 0.63
3 0.63
4 0.64
5 0.64
6 0.61
7 0.59
8 0.58
9 0.59
10 0.58
11 0.54
12 0.48
13 0.43
14 0.37
15 0.35
16 0.36
17 0.29
18 0.28
19 0.28
20 0.27
21 0.24
22 0.24
23 0.22
24 0.2
25 0.2
26 0.19
27 0.18
28 0.17
29 0.21
30 0.24
31 0.25
32 0.26
33 0.25
34 0.26
35 0.26
36 0.33
37 0.33
38 0.34
39 0.35
40 0.39
41 0.39
42 0.37
43 0.36
44 0.28
45 0.24
46 0.2
47 0.22
48 0.18
49 0.18
50 0.19
51 0.19
52 0.2
53 0.27
54 0.27
55 0.25
56 0.24
57 0.25
58 0.25
59 0.32
60 0.39
61 0.37
62 0.43
63 0.44
64 0.45
65 0.5
66 0.47
67 0.46
68 0.46
69 0.49
70 0.53
71 0.56
72 0.64
73 0.61
74 0.62
75 0.62
76 0.61
77 0.61
78 0.55
79 0.58
80 0.54
81 0.57
82 0.61
83 0.6
84 0.58
85 0.53
86 0.52
87 0.47
88 0.44
89 0.41
90 0.39
91 0.37
92 0.42
93 0.46
94 0.5
95 0.56
96 0.64
97 0.7
98 0.77
99 0.85
100 0.86
101 0.89
102 0.93
103 0.92
104 0.92
105 0.91
106 0.87