Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A4U0TYN0

Protein Details
Accession A0A4U0TYN0    Localization Confidence Low Confidence Score 5.9
NoLS Segment(s)
PositionSequenceProtein Nature
23-47LSRLHPRHLRRSPSRHYERSRHLNSBasic
NLS Segment(s)
Subcellular Location(s) mito 22, nucl 2.5, cyto_nucl 2.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR038716  P1/P2_N_sf  
IPR027534  Ribosomal_L12/P1/P2  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006414  P:translational elongation  
Pfam View protein in Pfam  
PF00428  Ribosomal_60s  
CDD cd05831  Ribosomal_P1  
Amino Acid Sequences MRILPLFDRTRQLRAAQLALTELSRLHPRHLRRSPSRHYERSRHLNSPTNSTPTMSTAELATSYAALILADDGVEITADKLNSLIQAAQVPDVEPIWSQLFAKALEGKDVKELLTNVGGGGAPAAVAAAPAAAAPAAGGDAAPAAEKKAEEKEESDEDMGFGLFD
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.4
2 0.39
3 0.32
4 0.29
5 0.26
6 0.23
7 0.21
8 0.16
9 0.12
10 0.12
11 0.18
12 0.19
13 0.23
14 0.29
15 0.35
16 0.45
17 0.53
18 0.6
19 0.63
20 0.72
21 0.75
22 0.79
23 0.83
24 0.81
25 0.81
26 0.8
27 0.79
28 0.81
29 0.77
30 0.72
31 0.68
32 0.67
33 0.61
34 0.6
35 0.54
36 0.48
37 0.42
38 0.38
39 0.33
40 0.26
41 0.27
42 0.19
43 0.16
44 0.12
45 0.11
46 0.11
47 0.1
48 0.08
49 0.05
50 0.05
51 0.04
52 0.04
53 0.03
54 0.03
55 0.03
56 0.03
57 0.02
58 0.02
59 0.02
60 0.02
61 0.02
62 0.02
63 0.03
64 0.04
65 0.04
66 0.04
67 0.05
68 0.05
69 0.05
70 0.05
71 0.05
72 0.04
73 0.06
74 0.06
75 0.07
76 0.07
77 0.07
78 0.07
79 0.07
80 0.07
81 0.05
82 0.07
83 0.07
84 0.08
85 0.08
86 0.08
87 0.09
88 0.09
89 0.11
90 0.12
91 0.12
92 0.16
93 0.17
94 0.17
95 0.18
96 0.18
97 0.17
98 0.15
99 0.16
100 0.12
101 0.12
102 0.12
103 0.09
104 0.09
105 0.09
106 0.06
107 0.06
108 0.04
109 0.03
110 0.03
111 0.03
112 0.02
113 0.02
114 0.02
115 0.02
116 0.02
117 0.02
118 0.02
119 0.02
120 0.02
121 0.02
122 0.02
123 0.03
124 0.03
125 0.02
126 0.02
127 0.03
128 0.03
129 0.04
130 0.04
131 0.05
132 0.07
133 0.07
134 0.11
135 0.17
136 0.21
137 0.23
138 0.25
139 0.3
140 0.33
141 0.36
142 0.34
143 0.27
144 0.24
145 0.22