Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A4V5N6G2

Protein Details
Accession A0A4V5N6G2   
Localization Confidence High
Confidence Score 16
NoLS Segment(s)
PositionSequenceProtein Nature
1-49MKVGKPTSKRTPVRLRHKIQKSSANKQRKQRKEAKTNPQWRSRIKKDPGHydrophilic
NLS Segment(s)
PositionSequence
5-51KPTSKRTPVRLRHKIQKSSANKQRKQRKEAKTNPQWRSRIKKDPGVP
57-84KGKILAEIEEKRRAKEEEQLKKREIAKA
Subcellular Location(s) nucl 18, mito 4, cyto 4, cyto_mito 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR014813  Gnl3_N_dom  
IPR023179  GTP-bd_ortho_bundle_sf  
Pfam View protein in Pfam  
PF08701  GN3L_Grn1  
Amino Acid Sequences MKVGKPTSKRTPVRLRHKIQKSSANKQRKQRKEAKTNPQWRSRIKKDPGVPNLFPYKGKILAEIEEKRRAKEEEQLKKREIAKAQRQGKPVVAQAPVQSAAEIVMDGEEGLIDPEAEDEMEVQDESNPMAALLASAQARASAYTQDDEEDEDDESEDDEDWDGIDEAALSAPGNPQRKVLPKQALADPIKAVTVLIDRMQKTTDGIQRMLDHYNIPPLVTAGSDTTSRYLVEVARKRGRLGRGGVPNLHSSALTVLTDLNEGRMVLPAAPGPAKKAGNAAGKSEVKIVSGMAKPFQIEGLFGDDGDADAMAVES
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.86
2 0.85
3 0.85
4 0.89
5 0.88
6 0.85
7 0.85
8 0.82
9 0.83
10 0.84
11 0.84
12 0.81
13 0.82
14 0.85
15 0.85
16 0.86
17 0.86
18 0.86
19 0.87
20 0.9
21 0.91
22 0.91
23 0.92
24 0.9
25 0.89
26 0.86
27 0.84
28 0.83
29 0.81
30 0.81
31 0.77
32 0.78
33 0.77
34 0.8
35 0.8
36 0.78
37 0.7
38 0.65
39 0.64
40 0.57
41 0.49
42 0.42
43 0.36
44 0.32
45 0.31
46 0.29
47 0.24
48 0.26
49 0.33
50 0.37
51 0.38
52 0.43
53 0.44
54 0.42
55 0.44
56 0.44
57 0.37
58 0.4
59 0.45
60 0.46
61 0.54
62 0.59
63 0.57
64 0.6
65 0.62
66 0.6
67 0.57
68 0.56
69 0.58
70 0.62
71 0.69
72 0.68
73 0.68
74 0.63
75 0.59
76 0.52
77 0.45
78 0.39
79 0.32
80 0.27
81 0.25
82 0.25
83 0.23
84 0.19
85 0.16
86 0.11
87 0.1
88 0.08
89 0.07
90 0.04
91 0.03
92 0.03
93 0.03
94 0.03
95 0.02
96 0.02
97 0.03
98 0.03
99 0.03
100 0.03
101 0.03
102 0.03
103 0.03
104 0.03
105 0.03
106 0.04
107 0.04
108 0.04
109 0.04
110 0.05
111 0.05
112 0.05
113 0.05
114 0.05
115 0.04
116 0.04
117 0.04
118 0.03
119 0.03
120 0.05
121 0.05
122 0.05
123 0.05
124 0.05
125 0.06
126 0.06
127 0.07
128 0.06
129 0.07
130 0.08
131 0.08
132 0.08
133 0.08
134 0.09
135 0.08
136 0.08
137 0.07
138 0.06
139 0.06
140 0.06
141 0.06
142 0.06
143 0.05
144 0.04
145 0.04
146 0.04
147 0.04
148 0.04
149 0.04
150 0.03
151 0.03
152 0.03
153 0.03
154 0.03
155 0.03
156 0.03
157 0.03
158 0.05
159 0.1
160 0.13
161 0.13
162 0.15
163 0.19
164 0.26
165 0.31
166 0.37
167 0.39
168 0.4
169 0.43
170 0.44
171 0.49
172 0.43
173 0.4
174 0.32
175 0.25
176 0.22
177 0.18
178 0.15
179 0.08
180 0.07
181 0.07
182 0.09
183 0.13
184 0.14
185 0.15
186 0.15
187 0.15
188 0.15
189 0.21
190 0.23
191 0.21
192 0.22
193 0.23
194 0.24
195 0.26
196 0.26
197 0.21
198 0.17
199 0.15
200 0.19
201 0.17
202 0.15
203 0.13
204 0.12
205 0.11
206 0.1
207 0.1
208 0.06
209 0.08
210 0.08
211 0.09
212 0.1
213 0.1
214 0.1
215 0.1
216 0.1
217 0.12
218 0.2
219 0.26
220 0.34
221 0.4
222 0.41
223 0.43
224 0.48
225 0.49
226 0.46
227 0.44
228 0.44
229 0.46
230 0.49
231 0.49
232 0.46
233 0.44
234 0.38
235 0.34
236 0.25
237 0.17
238 0.15
239 0.13
240 0.11
241 0.09
242 0.08
243 0.08
244 0.1
245 0.09
246 0.09
247 0.08
248 0.08
249 0.08
250 0.09
251 0.1
252 0.09
253 0.1
254 0.1
255 0.11
256 0.14
257 0.14
258 0.15
259 0.21
260 0.22
261 0.21
262 0.24
263 0.29
264 0.35
265 0.37
266 0.37
267 0.38
268 0.4
269 0.4
270 0.4
271 0.33
272 0.25
273 0.24
274 0.22
275 0.2
276 0.22
277 0.23
278 0.21
279 0.22
280 0.21
281 0.21
282 0.23
283 0.17
284 0.14
285 0.13
286 0.17
287 0.16
288 0.15
289 0.15
290 0.13
291 0.13
292 0.12
293 0.11
294 0.05