Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A4U0UBU7

Protein Details
Accession A0A4U0UBU7    Localization Confidence Low Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
5-26EEEGRRGGKRRRRYVELRKLLSBasic
NLS Segment(s)
PositionSequence
9-17RRGGKRRRR
Subcellular Location(s) mito 21.5, mito_nucl 12.666, cyto_nucl 3.833, cyto 3
Family & Domain DBs
Amino Acid Sequences MQREEEEGRRGGKRRRRYVELRKLLSLAAGLKEATVTQGKPEVYVRLASQQASGPGFCPGPFTTGAVSDV
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.66
2 0.71
3 0.75
4 0.79
5 0.84
6 0.86
7 0.86
8 0.79
9 0.69
10 0.62
11 0.53
12 0.43
13 0.32
14 0.22
15 0.13
16 0.1
17 0.08
18 0.07
19 0.07
20 0.07
21 0.07
22 0.07
23 0.07
24 0.07
25 0.11
26 0.11
27 0.12
28 0.13
29 0.13
30 0.13
31 0.14
32 0.14
33 0.15
34 0.17
35 0.16
36 0.16
37 0.16
38 0.18
39 0.18
40 0.17
41 0.13
42 0.14
43 0.14
44 0.13
45 0.16
46 0.14
47 0.15
48 0.16
49 0.17
50 0.16