Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A4U0TYK2

Protein Details
Accession A0A4U0TYK2   
Localization Confidence Medium
Confidence Score 10
NoLS Segment(s)
PositionSequenceProtein Nature
67-104LREGPWKSGEKKQKQKKDKRQKKDKKQKYKLAKAFTPSBasic
NLS Segment(s)
PositionSequence
55-60RGGRGH
63-98AATGLREGPWKSGEKKQKQKKDKRQKKDKKQKYKLA
Subcellular Location(s) extr 9, plas 8, E.R. 4, mito 3, vacu 3
Family & Domain DBs
Gene Ontology GO:0016020  C:membrane  
Amino Acid Sequences MGAVASCFNSVVSAITACFMAVVNAIVTVVKAIISGIVAIFYAIASVLTCGKVKRGGRGHTSAATGLREGPWKSGEKKQKQKKDKRQKKDKKQKYKLAKAFTPSPVD
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.08
2 0.08
3 0.08
4 0.07
5 0.07
6 0.06
7 0.05
8 0.05
9 0.05
10 0.05
11 0.05
12 0.05
13 0.04
14 0.04
15 0.04
16 0.04
17 0.03
18 0.03
19 0.03
20 0.03
21 0.03
22 0.03
23 0.03
24 0.03
25 0.03
26 0.03
27 0.03
28 0.03
29 0.03
30 0.02
31 0.02
32 0.02
33 0.03
34 0.04
35 0.05
36 0.06
37 0.06
38 0.07
39 0.13
40 0.14
41 0.21
42 0.27
43 0.3
44 0.34
45 0.38
46 0.39
47 0.35
48 0.35
49 0.28
50 0.24
51 0.2
52 0.15
53 0.12
54 0.11
55 0.14
56 0.13
57 0.14
58 0.16
59 0.19
60 0.23
61 0.31
62 0.4
63 0.47
64 0.57
65 0.66
66 0.74
67 0.81
68 0.89
69 0.92
70 0.93
71 0.93
72 0.94
73 0.95
74 0.96
75 0.96
76 0.96
77 0.96
78 0.96
79 0.96
80 0.95
81 0.95
82 0.95
83 0.92
84 0.9
85 0.84
86 0.8
87 0.76