Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A4V5N615

Protein Details
Accession A0A4V5N615    Localization Confidence Low Confidence Score 6.6
NoLS Segment(s)
PositionSequenceProtein Nature
12-38CSLCSVCFGKKKQKKQQEQQEQQEQQEHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 21, nucl 4
Family & Domain DBs
Amino Acid Sequences MPLVRREVYFVCSLCSVCFGKKKQKKQQEQQEQQEQQEQQEQQEQQEQKKKERKPITQNSSTVQAKAIKGTSFTIRLGWANVYLFRSGNSRVTQ
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.19
2 0.22
3 0.2
4 0.2
5 0.27
6 0.3
7 0.4
8 0.49
9 0.59
10 0.66
11 0.75
12 0.81
13 0.85
14 0.9
15 0.91
16 0.91
17 0.89
18 0.89
19 0.81
20 0.72
21 0.67
22 0.56
23 0.46
24 0.43
25 0.34
26 0.25
27 0.28
28 0.27
29 0.23
30 0.29
31 0.3
32 0.29
33 0.36
34 0.37
35 0.4
36 0.48
37 0.5
38 0.53
39 0.6
40 0.64
41 0.67
42 0.75
43 0.75
44 0.73
45 0.71
46 0.64
47 0.62
48 0.54
49 0.43
50 0.35
51 0.31
52 0.25
53 0.25
54 0.25
55 0.18
56 0.19
57 0.21
58 0.21
59 0.2
60 0.2
61 0.18
62 0.18
63 0.19
64 0.19
65 0.17
66 0.16
67 0.15
68 0.17
69 0.18
70 0.17
71 0.17
72 0.16
73 0.19
74 0.2