Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A4U0TP76

Protein Details
Accession A0A4U0TP76   
Localization Confidence Medium
Confidence Score 14.5
NoLS Segment(s)
PositionSequenceProtein Nature
53-83TSNGRRDVFPKDSRHRRDRDKGYRHLRLDRDBasic
87-106GSGRPGKDERHNREPRRDLIBasic
109-131GREERRRKYPEARPDRERKREFTBasic
NLS Segment(s)
PositionSequence
65-128SRHRRDRDKGYRHLRLDRDDEGGSGRPGKDERHNREPRRDLIDGGREERRRKYPEARPDRERKR
Subcellular Location(s) mito 17, cyto 5, nucl 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR043837  Mtf2-like_C  
IPR040009  Mtf2/C5D6.12-like  
Gene Ontology GO:0005739  C:mitochondrion  
Pfam View protein in Pfam  
PF19189  Mtf2  
Amino Acid Sequences MAKEVARRSQASIPRNTISTEHTFLPVLYCTPTIQRRAFHVSTTDRTGTDWKTSNGRRDVFPKDSRHRRDRDKGYRHLRLDRDDEGGSGRPGKDERHNREPRRDLIDGGREERRRKYPEARPDRERKREFTPRIDHVPFEGMRDNQDASLDFEKSTVTPAERKTFQKLFDMRRIQSESKASGDDKQVDLDGILETAVDRIGPKDRAVAQFPPELQPMADAARDRRLAERENADLALERLKADAIQTQLNYVQTFLDASNTDLELWQNLTKHVLNRIAALDLDQPAPTPRALAASDAWRTLRHRFLKKTHHVNPAAAYPATDHQLSELALLTATTPPLLAHYHNIATRNFPGSTLPLNLLPTLRALGPSAFAFAASTAVYNAHMTLSYTLYGAHAVHGITETLAEMERGVYGFDEDTLALVLKVLKDAKRGRAGLWGPGLAVLWGGEGVGRAVREVVRWREVVENFRMEGALRKAREVDGVGEDGVGFV
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.54
2 0.53
3 0.5
4 0.44
5 0.42
6 0.4
7 0.35
8 0.31
9 0.3
10 0.29
11 0.27
12 0.27
13 0.22
14 0.17
15 0.16
16 0.16
17 0.15
18 0.22
19 0.28
20 0.33
21 0.37
22 0.38
23 0.42
24 0.5
25 0.5
26 0.45
27 0.46
28 0.45
29 0.46
30 0.5
31 0.45
32 0.36
33 0.37
34 0.41
35 0.36
36 0.36
37 0.35
38 0.32
39 0.4
40 0.46
41 0.53
42 0.55
43 0.55
44 0.53
45 0.55
46 0.6
47 0.58
48 0.6
49 0.61
50 0.64
51 0.72
52 0.77
53 0.8
54 0.82
55 0.83
56 0.86
57 0.87
58 0.88
59 0.86
60 0.87
61 0.88
62 0.88
63 0.84
64 0.82
65 0.77
66 0.72
67 0.68
68 0.6
69 0.54
70 0.44
71 0.39
72 0.33
73 0.29
74 0.24
75 0.23
76 0.21
77 0.2
78 0.21
79 0.25
80 0.32
81 0.41
82 0.48
83 0.55
84 0.65
85 0.69
86 0.78
87 0.8
88 0.76
89 0.73
90 0.66
91 0.58
92 0.54
93 0.55
94 0.48
95 0.46
96 0.48
97 0.45
98 0.48
99 0.52
100 0.53
101 0.5
102 0.54
103 0.6
104 0.61
105 0.67
106 0.74
107 0.75
108 0.76
109 0.81
110 0.84
111 0.85
112 0.81
113 0.75
114 0.73
115 0.76
116 0.73
117 0.72
118 0.7
119 0.65
120 0.68
121 0.65
122 0.56
123 0.46
124 0.46
125 0.36
126 0.31
127 0.29
128 0.21
129 0.22
130 0.24
131 0.22
132 0.17
133 0.17
134 0.15
135 0.16
136 0.18
137 0.16
138 0.14
139 0.13
140 0.14
141 0.13
142 0.14
143 0.12
144 0.11
145 0.15
146 0.19
147 0.25
148 0.29
149 0.32
150 0.37
151 0.39
152 0.39
153 0.43
154 0.47
155 0.47
156 0.52
157 0.56
158 0.49
159 0.51
160 0.56
161 0.48
162 0.45
163 0.43
164 0.35
165 0.3
166 0.31
167 0.26
168 0.24
169 0.26
170 0.25
171 0.21
172 0.2
173 0.18
174 0.16
175 0.15
176 0.12
177 0.08
178 0.05
179 0.05
180 0.04
181 0.04
182 0.04
183 0.04
184 0.03
185 0.03
186 0.05
187 0.09
188 0.1
189 0.1
190 0.14
191 0.18
192 0.21
193 0.24
194 0.25
195 0.24
196 0.25
197 0.26
198 0.25
199 0.21
200 0.19
201 0.15
202 0.13
203 0.11
204 0.1
205 0.1
206 0.09
207 0.09
208 0.14
209 0.15
210 0.16
211 0.18
212 0.2
213 0.21
214 0.24
215 0.25
216 0.22
217 0.22
218 0.21
219 0.18
220 0.16
221 0.14
222 0.12
223 0.09
224 0.08
225 0.07
226 0.07
227 0.07
228 0.07
229 0.09
230 0.08
231 0.1
232 0.1
233 0.11
234 0.12
235 0.13
236 0.12
237 0.1
238 0.08
239 0.07
240 0.08
241 0.07
242 0.07
243 0.06
244 0.07
245 0.08
246 0.08
247 0.08
248 0.07
249 0.07
250 0.06
251 0.08
252 0.08
253 0.08
254 0.08
255 0.11
256 0.12
257 0.13
258 0.17
259 0.19
260 0.18
261 0.19
262 0.19
263 0.17
264 0.16
265 0.15
266 0.13
267 0.1
268 0.11
269 0.09
270 0.09
271 0.09
272 0.11
273 0.09
274 0.08
275 0.07
276 0.09
277 0.09
278 0.1
279 0.11
280 0.14
281 0.15
282 0.16
283 0.16
284 0.16
285 0.18
286 0.2
287 0.27
288 0.31
289 0.38
290 0.44
291 0.52
292 0.61
293 0.67
294 0.74
295 0.74
296 0.75
297 0.69
298 0.64
299 0.58
300 0.49
301 0.43
302 0.33
303 0.24
304 0.16
305 0.15
306 0.16
307 0.14
308 0.12
309 0.09
310 0.11
311 0.11
312 0.1
313 0.09
314 0.07
315 0.07
316 0.07
317 0.07
318 0.06
319 0.06
320 0.05
321 0.05
322 0.05
323 0.07
324 0.08
325 0.09
326 0.11
327 0.13
328 0.16
329 0.18
330 0.21
331 0.2
332 0.22
333 0.23
334 0.24
335 0.22
336 0.19
337 0.19
338 0.19
339 0.2
340 0.19
341 0.18
342 0.16
343 0.17
344 0.17
345 0.16
346 0.13
347 0.12
348 0.12
349 0.1
350 0.09
351 0.09
352 0.09
353 0.1
354 0.1
355 0.11
356 0.09
357 0.09
358 0.09
359 0.08
360 0.08
361 0.07
362 0.07
363 0.05
364 0.06
365 0.07
366 0.07
367 0.07
368 0.07
369 0.07
370 0.08
371 0.09
372 0.1
373 0.09
374 0.09
375 0.09
376 0.09
377 0.1
378 0.09
379 0.08
380 0.09
381 0.08
382 0.08
383 0.09
384 0.08
385 0.07
386 0.07
387 0.06
388 0.06
389 0.06
390 0.06
391 0.05
392 0.05
393 0.06
394 0.06
395 0.06
396 0.06
397 0.07
398 0.07
399 0.07
400 0.08
401 0.07
402 0.07
403 0.07
404 0.07
405 0.06
406 0.07
407 0.08
408 0.07
409 0.11
410 0.15
411 0.17
412 0.25
413 0.31
414 0.38
415 0.45
416 0.47
417 0.44
418 0.49
419 0.49
420 0.47
421 0.44
422 0.37
423 0.28
424 0.27
425 0.26
426 0.17
427 0.15
428 0.09
429 0.05
430 0.05
431 0.04
432 0.04
433 0.04
434 0.05
435 0.07
436 0.07
437 0.07
438 0.09
439 0.1
440 0.14
441 0.22
442 0.27
443 0.3
444 0.31
445 0.33
446 0.39
447 0.42
448 0.44
449 0.42
450 0.4
451 0.36
452 0.36
453 0.34
454 0.27
455 0.3
456 0.32
457 0.33
458 0.31
459 0.32
460 0.34
461 0.35
462 0.38
463 0.33
464 0.29
465 0.25
466 0.26
467 0.23
468 0.21