Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A4U0TYV9

Protein Details
Accession A0A4U0TYV9    Localization Confidence Medium Confidence Score 11.6
NoLS Segment(s)
PositionSequenceProtein Nature
90-129FNPSHRVRKRRHGFLARLRTRTGRKVLLRRKLKGRNTLSHBasic
NLS Segment(s)
PositionSequence
93-124SHRVRKRRHGFLARLRTRTGRKVLLRRKLKGR
Subcellular Location(s) mito 16, nucl 9
Family & Domain DBs
InterPro View protein in InterPro  
IPR000271  Ribosomal_L34  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF00468  Ribosomal_L34  
Amino Acid Sequences MSCLRPLRTAFTTSKPLTAALRQTTRPLLPEPHLQQHQQLQLQFQQRPFALLTRPTRPTLPHTTNLETPALTTPSLLPLQLARGAKRDTFNPSHRVRKRRHGFLARLRTRTGRKVLLRRKLKGRNTLSH
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.42
2 0.36
3 0.35
4 0.33
5 0.33
6 0.34
7 0.32
8 0.36
9 0.35
10 0.38
11 0.4
12 0.38
13 0.36
14 0.32
15 0.3
16 0.29
17 0.36
18 0.38
19 0.41
20 0.43
21 0.42
22 0.42
23 0.43
24 0.44
25 0.39
26 0.35
27 0.3
28 0.33
29 0.38
30 0.37
31 0.32
32 0.31
33 0.27
34 0.28
35 0.26
36 0.22
37 0.18
38 0.22
39 0.26
40 0.27
41 0.3
42 0.3
43 0.3
44 0.3
45 0.34
46 0.36
47 0.36
48 0.36
49 0.37
50 0.38
51 0.39
52 0.38
53 0.33
54 0.24
55 0.2
56 0.16
57 0.13
58 0.1
59 0.09
60 0.08
61 0.1
62 0.1
63 0.09
64 0.08
65 0.07
66 0.09
67 0.13
68 0.14
69 0.12
70 0.17
71 0.19
72 0.21
73 0.22
74 0.23
75 0.26
76 0.32
77 0.36
78 0.4
79 0.44
80 0.53
81 0.59
82 0.65
83 0.65
84 0.69
85 0.74
86 0.75
87 0.79
88 0.78
89 0.8
90 0.81
91 0.86
92 0.82
93 0.76
94 0.69
95 0.67
96 0.63
97 0.62
98 0.58
99 0.56
100 0.58
101 0.65
102 0.72
103 0.75
104 0.79
105 0.79
106 0.83
107 0.84
108 0.83
109 0.83