Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A4U0TK83

Protein Details
Accession A0A4U0TK83    Localization Confidence Low Confidence Score 7.7
NoLS Segment(s)
PositionSequenceProtein Nature
28-47QSLQTFKKRHDDARRRVQLLHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 16, nucl 7, cyto 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR008689  ATP_synth_F0_dsu_mt  
IPR036228  ATP_synth_F0_dsu_sf_mt  
Gene Ontology GO:0000276  C:mitochondrial proton-transporting ATP synthase complex, coupling factor F(o)  
GO:0015078  F:proton transmembrane transporter activity  
GO:0015986  P:proton motive force-driven ATP synthesis  
Pfam View protein in Pfam  
PF05873  Mt_ATP-synt_D  
Amino Acid Sequences MAAARTAVQKIDWATLPQKLGLRGSTAQSLQTFKKRHDDARRRVQLLSEQPQTVDFAQYRSILKNQAIVDDIEKQVGSFQVKKYDVGRQIKSIEAFEAQAVKSAEETKGKVDAELKDLEATLKNIESARPFEDLTVDEVVAARPEIDERVSQLVSKGRWAVPGYNEKFGNLSML
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.23
2 0.26
3 0.27
4 0.27
5 0.28
6 0.27
7 0.28
8 0.25
9 0.27
10 0.25
11 0.26
12 0.27
13 0.24
14 0.25
15 0.25
16 0.27
17 0.28
18 0.34
19 0.34
20 0.33
21 0.42
22 0.44
23 0.51
24 0.59
25 0.65
26 0.66
27 0.75
28 0.81
29 0.73
30 0.69
31 0.62
32 0.58
33 0.56
34 0.53
35 0.45
36 0.37
37 0.35
38 0.35
39 0.35
40 0.27
41 0.22
42 0.15
43 0.12
44 0.14
45 0.16
46 0.17
47 0.17
48 0.18
49 0.18
50 0.18
51 0.22
52 0.2
53 0.19
54 0.19
55 0.17
56 0.17
57 0.17
58 0.16
59 0.12
60 0.11
61 0.1
62 0.09
63 0.11
64 0.12
65 0.11
66 0.12
67 0.19
68 0.2
69 0.21
70 0.22
71 0.27
72 0.32
73 0.36
74 0.36
75 0.32
76 0.32
77 0.33
78 0.32
79 0.26
80 0.19
81 0.13
82 0.12
83 0.1
84 0.1
85 0.08
86 0.11
87 0.11
88 0.1
89 0.1
90 0.11
91 0.13
92 0.13
93 0.14
94 0.12
95 0.15
96 0.15
97 0.16
98 0.18
99 0.18
100 0.19
101 0.19
102 0.18
103 0.15
104 0.15
105 0.15
106 0.13
107 0.12
108 0.1
109 0.09
110 0.1
111 0.1
112 0.12
113 0.13
114 0.15
115 0.16
116 0.17
117 0.17
118 0.15
119 0.17
120 0.16
121 0.16
122 0.15
123 0.13
124 0.11
125 0.11
126 0.11
127 0.1
128 0.09
129 0.06
130 0.05
131 0.06
132 0.08
133 0.09
134 0.1
135 0.12
136 0.16
137 0.16
138 0.16
139 0.19
140 0.23
141 0.22
142 0.25
143 0.27
144 0.24
145 0.29
146 0.31
147 0.32
148 0.34
149 0.44
150 0.45
151 0.47
152 0.46
153 0.42
154 0.4