Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A4U0TNV3

Protein Details
Accession A0A4U0TNV3   
Localization Confidence Medium
Confidence Score 10.9
NoLS Segment(s)
PositionSequenceProtein Nature
164-187SNEVMKHGPPKSKKKRFIDSMGRAHydrophilic
NLS Segment(s)
PositionSequence
171-179GPPKSKKKR
Subcellular Location(s) nucl 10.5, pero 9, cyto_nucl 7.833, cyto_mito 4.333, cyto 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR046670  DUF6540  
Pfam View protein in Pfam  
PF20174  DUF6540  
Amino Acid Sequences MANKDRICIETFHRNELSIGEANRQALKNDAYHWAVLVRPKDIDSLATCTSFDVTNGSRQIPASSGRNEETNPDGDWWFRRRHPVNPLATGQFLTAVVIGKLPENVLIKDVESVLESVPLPRKNYTPKESCSTWTVLAIIALQQAGYADQLDVDGIMRAAVLESNEVMKHGPPKSKKKRFIDSMGRA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.37
2 0.36
3 0.33
4 0.32
5 0.26
6 0.25
7 0.22
8 0.23
9 0.24
10 0.28
11 0.28
12 0.24
13 0.23
14 0.24
15 0.22
16 0.23
17 0.26
18 0.24
19 0.23
20 0.22
21 0.19
22 0.19
23 0.22
24 0.22
25 0.18
26 0.17
27 0.18
28 0.19
29 0.18
30 0.19
31 0.16
32 0.19
33 0.19
34 0.19
35 0.18
36 0.17
37 0.17
38 0.15
39 0.13
40 0.11
41 0.11
42 0.15
43 0.17
44 0.17
45 0.17
46 0.18
47 0.18
48 0.16
49 0.18
50 0.17
51 0.18
52 0.2
53 0.2
54 0.21
55 0.21
56 0.21
57 0.2
58 0.18
59 0.16
60 0.15
61 0.14
62 0.14
63 0.18
64 0.19
65 0.2
66 0.2
67 0.29
68 0.3
69 0.36
70 0.43
71 0.47
72 0.47
73 0.47
74 0.47
75 0.39
76 0.37
77 0.31
78 0.23
79 0.16
80 0.11
81 0.08
82 0.06
83 0.05
84 0.05
85 0.05
86 0.05
87 0.05
88 0.05
89 0.05
90 0.07
91 0.08
92 0.08
93 0.09
94 0.09
95 0.09
96 0.1
97 0.1
98 0.07
99 0.06
100 0.07
101 0.06
102 0.07
103 0.07
104 0.08
105 0.14
106 0.16
107 0.18
108 0.19
109 0.23
110 0.31
111 0.38
112 0.44
113 0.44
114 0.46
115 0.49
116 0.49
117 0.48
118 0.43
119 0.38
120 0.31
121 0.26
122 0.22
123 0.16
124 0.15
125 0.12
126 0.09
127 0.07
128 0.06
129 0.05
130 0.05
131 0.05
132 0.05
133 0.05
134 0.05
135 0.04
136 0.04
137 0.05
138 0.05
139 0.05
140 0.05
141 0.05
142 0.04
143 0.04
144 0.04
145 0.04
146 0.04
147 0.05
148 0.05
149 0.06
150 0.07
151 0.09
152 0.09
153 0.1
154 0.1
155 0.12
156 0.19
157 0.23
158 0.32
159 0.39
160 0.51
161 0.62
162 0.72
163 0.8
164 0.82
165 0.87
166 0.87
167 0.88