Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A4U0TUP5

Protein Details
Accession A0A4U0TUP5   
Localization Confidence Low
Confidence Score 8.6
NoLS Segment(s)
PositionSequenceProtein Nature
175-203FNYQHPQAGSRRCRRKRKSVSWHALVRQAHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 12.5, mito 10, cyto_nucl 8.5, cyto 3.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR039113  ATG29  
IPR040666  Atg29_N  
IPR039362  ATG29_sf  
Gene Ontology GO:0000407  C:phagophore assembly site  
GO:0000045  P:autophagosome assembly  
GO:0015031  P:protein transport  
Pfam View protein in Pfam  
PF18388  ATG29_N  
Amino Acid Sequences MSPSSSANTVSKPIAPPSSHSRHTSAASIKQQQSYQQQQPIPSKAPSPRLETKKSGVHYTCFIRLPFPRNGFEDPPPTEWDATKDRTLWKLVSKAANPSDLDWDGIADRLGVSKAFLFQQAAWLYDRHFEGMRKVMRMGAVPGHASSPVPAESGSSSVAAGQIGGVAMARLKDAFNYQHPQAGSRRCRRKRKSVSWHALVRQACDLAHAFNYNCDAEQTAGRQRR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.32
2 0.31
3 0.34
4 0.4
5 0.46
6 0.47
7 0.48
8 0.47
9 0.45
10 0.46
11 0.47
12 0.44
13 0.44
14 0.47
15 0.53
16 0.52
17 0.52
18 0.51
19 0.52
20 0.55
21 0.55
22 0.55
23 0.53
24 0.52
25 0.55
26 0.61
27 0.59
28 0.54
29 0.47
30 0.45
31 0.44
32 0.5
33 0.46
34 0.48
35 0.52
36 0.55
37 0.6
38 0.58
39 0.57
40 0.55
41 0.54
42 0.55
43 0.47
44 0.42
45 0.41
46 0.4
47 0.39
48 0.35
49 0.33
50 0.29
51 0.31
52 0.34
53 0.37
54 0.37
55 0.36
56 0.37
57 0.41
58 0.4
59 0.39
60 0.4
61 0.35
62 0.34
63 0.34
64 0.31
65 0.28
66 0.25
67 0.25
68 0.24
69 0.24
70 0.23
71 0.22
72 0.23
73 0.25
74 0.27
75 0.24
76 0.24
77 0.24
78 0.26
79 0.29
80 0.27
81 0.3
82 0.3
83 0.31
84 0.27
85 0.25
86 0.24
87 0.2
88 0.19
89 0.13
90 0.12
91 0.09
92 0.09
93 0.08
94 0.04
95 0.04
96 0.04
97 0.04
98 0.04
99 0.04
100 0.04
101 0.05
102 0.06
103 0.06
104 0.07
105 0.06
106 0.12
107 0.12
108 0.13
109 0.13
110 0.13
111 0.13
112 0.14
113 0.15
114 0.11
115 0.12
116 0.11
117 0.13
118 0.2
119 0.22
120 0.2
121 0.2
122 0.2
123 0.2
124 0.2
125 0.18
126 0.13
127 0.12
128 0.12
129 0.12
130 0.11
131 0.1
132 0.1
133 0.09
134 0.08
135 0.08
136 0.08
137 0.07
138 0.08
139 0.08
140 0.09
141 0.1
142 0.08
143 0.08
144 0.07
145 0.08
146 0.07
147 0.06
148 0.04
149 0.04
150 0.03
151 0.03
152 0.03
153 0.03
154 0.03
155 0.04
156 0.04
157 0.05
158 0.05
159 0.06
160 0.1
161 0.13
162 0.18
163 0.23
164 0.24
165 0.28
166 0.28
167 0.3
168 0.34
169 0.4
170 0.45
171 0.5
172 0.61
173 0.66
174 0.77
175 0.83
176 0.88
177 0.89
178 0.9
179 0.91
180 0.92
181 0.92
182 0.89
183 0.88
184 0.8
185 0.76
186 0.66
187 0.57
188 0.48
189 0.39
190 0.31
191 0.26
192 0.23
193 0.18
194 0.19
195 0.2
196 0.17
197 0.18
198 0.22
199 0.19
200 0.19
201 0.18
202 0.17
203 0.16
204 0.18
205 0.22