FuNGI

A0A4U0TPA0

Protein Details

Accession

A0A4U0TPA0

Localization Confidence

Medium

Confidence Score

11.6

NoLS Segment(s)

Position	Sequence	Protein Nature
2-30	PLSWRSTLFHKPPNPRKPASRRSNLSNAH	Hydrophilic
421-450	AMARAAVPPKPKPKPKPKPKPKPEQTMLAT	Hydrophilic

NLS Segment(s)

Position	Sequence
420-443	RAMARAAVPPKPKPKPKPKPKPKP

Subcellular Location(s)

mito 17, nucl 5, cyto 5, cyto_nucl 5

Family & Domain DBs

InterPro	View protein in InterPro IPR011990 TPR-like_helical_dom_sf

Amino Acid Sequences

MPLSWRSTLFHKPPNPRKPASRRSNLSNAHLDLWEHAALLYHNAEYKGALTTFTHLATTLLPRNPEASTQCTLNTSLIQARLGSYAAAAQTLETAAAVQTDGRALGLLTPYLLGLVEWELGNLVKAEACLEVCLRGLRLLEMGEVDYAREGLGFCLRNREVRGAEPLAPRDARTVVESTGELARFIRDAGVEMEREGGGFGGYVGGEVRGGGREVDAELELDLDLELESLLGLYGAREWEEEGGDVVAREVKGEGWRDSDCTRRHRASAAYKDNNSTEPNNTSLSPVTSRTTATAASNPKINSLPRNTYSRIPTPTSTYSPTSSILTPTTLTLLDPKTPQPLNPIPHLHTTGSETSSLFRSSMTTLARAEIAHSETLRALEGRARAPKSASSGGGNDNNNNITDVSAATPPDPVQAKPQRAMARAAVPPKPKPKPKPKPKPKPEQTMLATSTRPLVLMKPLPPWPERRGKFASVPQQQQAHQAHQAHQRQAKGDDSEDTAFRVRSSKIFEFMRRS

FASTA Sequence
with NoLS information

AlphaFold Structure
with highlighted NoLS

NoLS Predictions per Residue

Residue Number	Score
1	0.8
2	0.83
3	0.8
4	0.83
5	0.84
6	0.86
7	0.86
8	0.85
9	0.82
10	0.81
11	0.84
12	0.79
13	0.75
14	0.72
15	0.63
16	0.55
17	0.5
18	0.42
19	0.33
20	0.31
21	0.25
22	0.17
23	0.14
24	0.13
25	0.12
26	0.15
27	0.14
28	0.11
29	0.14
30	0.14
31	0.14
32	0.14
33	0.14
34	0.15
35	0.14
36	0.14
37	0.13
38	0.16
39	0.17
40	0.18
41	0.17
42	0.14
43	0.14
44	0.15
45	0.2
46	0.23
47	0.24
48	0.25
49	0.25
50	0.27
51	0.28
52	0.31
53	0.29
54	0.27
55	0.27
56	0.27
57	0.27
58	0.27
59	0.27
60	0.24
61	0.21
62	0.18
63	0.19
64	0.19
65	0.19
66	0.17
67	0.17
68	0.17
69	0.16
70	0.13
71	0.09
72	0.1
73	0.09
74	0.09
75	0.08
76	0.07
77	0.07
78	0.07
79	0.07
80	0.05
81	0.05
82	0.04
83	0.05
84	0.05
85	0.04
86	0.05
87	0.05
88	0.05
89	0.05
90	0.05
91	0.05
92	0.06
93	0.07
94	0.07
95	0.07
96	0.07
97	0.06
98	0.06
99	0.06
100	0.04
101	0.04
102	0.05
103	0.06
104	0.06
105	0.06
106	0.06
107	0.06
108	0.07
109	0.06
110	0.06
111	0.05
112	0.05
113	0.06
114	0.06
115	0.07
116	0.07
117	0.07
118	0.08
119	0.08
120	0.09
121	0.09
122	0.1
123	0.1
124	0.09
125	0.1
126	0.09
127	0.09
128	0.09
129	0.09
130	0.08
131	0.08
132	0.07
133	0.06
134	0.06
135	0.05
136	0.05
137	0.05
138	0.05
139	0.11
140	0.13
141	0.13
142	0.21
143	0.22
144	0.25
145	0.27
146	0.31
147	0.27
148	0.27
149	0.33
150	0.28
151	0.33
152	0.32
153	0.31
154	0.31
155	0.3
156	0.28
157	0.24
158	0.22
159	0.18
160	0.17
161	0.17
162	0.13
163	0.14
164	0.13
165	0.13
166	0.15
167	0.14
168	0.12
169	0.1
170	0.1
171	0.09
172	0.09
173	0.08
174	0.06
175	0.07
176	0.09
177	0.1
178	0.1
179	0.1
180	0.11
181	0.1
182	0.1
183	0.08
184	0.06
185	0.04
186	0.04
187	0.04
188	0.03
189	0.03
190	0.03
191	0.03
192	0.03
193	0.03
194	0.03
195	0.04
196	0.04
197	0.04
198	0.04
199	0.04
200	0.05
201	0.05
202	0.06
203	0.05
204	0.05
205	0.05
206	0.05
207	0.05
208	0.05
209	0.04
210	0.04
211	0.03
212	0.03
213	0.03
214	0.03
215	0.02
216	0.02
217	0.02
218	0.02
219	0.02
220	0.02
221	0.03
222	0.03
223	0.03
224	0.04
225	0.04
226	0.05
227	0.05
228	0.05
229	0.05
230	0.05
231	0.05
232	0.04
233	0.04
234	0.05
235	0.05
236	0.05
237	0.05
238	0.06
239	0.09
240	0.11
241	0.12
242	0.13
243	0.13
244	0.15
245	0.17
246	0.23
247	0.25
248	0.29
249	0.34
250	0.33
251	0.34
252	0.35
253	0.4
254	0.42
255	0.47
256	0.51
257	0.49
258	0.49
259	0.5
260	0.48
261	0.43
262	0.37
263	0.29
264	0.21
265	0.18
266	0.19
267	0.18
268	0.18
269	0.17
270	0.15
271	0.15
272	0.14
273	0.14
274	0.13
275	0.13
276	0.13
277	0.13
278	0.13
279	0.13
280	0.12
281	0.16
282	0.18
283	0.18
284	0.22
285	0.21
286	0.22
287	0.23
288	0.24
289	0.24
290	0.26
291	0.31
292	0.3
293	0.35
294	0.35
295	0.38
296	0.41
297	0.41
298	0.4
299	0.37
300	0.35
301	0.36
302	0.37
303	0.36
304	0.34
305	0.31
306	0.28
307	0.27
308	0.27
309	0.23
310	0.2
311	0.19
312	0.16
313	0.14
314	0.13
315	0.12
316	0.11
317	0.1
318	0.09
319	0.12
320	0.12
321	0.14
322	0.15
323	0.16
324	0.21
325	0.21
326	0.22
327	0.25
328	0.31
329	0.32
330	0.36
331	0.38
332	0.35
333	0.38
334	0.41
335	0.33
336	0.28
337	0.28
338	0.25
339	0.22
340	0.2
341	0.17
342	0.16
343	0.17
344	0.17
345	0.13
346	0.11
347	0.11
348	0.11
349	0.15
350	0.15
351	0.15
352	0.15
353	0.16
354	0.16
355	0.15
356	0.15
357	0.13
358	0.13
359	0.13
360	0.13
361	0.13
362	0.12
363	0.13
364	0.13
365	0.1
366	0.09
367	0.11
368	0.14
369	0.18
370	0.24
371	0.25
372	0.26
373	0.27
374	0.29
375	0.31
376	0.32
377	0.29
378	0.24
379	0.25
380	0.29
381	0.33
382	0.32
383	0.28
384	0.27
385	0.26
386	0.24
387	0.23
388	0.18
389	0.12
390	0.11
391	0.11
392	0.1
393	0.11
394	0.11
395	0.1
396	0.11
397	0.11
398	0.16
399	0.17
400	0.15
401	0.24
402	0.32
403	0.37
404	0.38
405	0.45
406	0.46
407	0.47
408	0.5
409	0.43
410	0.41
411	0.41
412	0.45
413	0.44
414	0.43
415	0.49
416	0.55
417	0.61
418	0.65
419	0.71
420	0.76
421	0.82
422	0.88
423	0.92
424	0.93
425	0.95
426	0.96
427	0.96
428	0.95
429	0.94
430	0.88
431	0.86
432	0.79
433	0.76
434	0.68
435	0.6
436	0.51
437	0.4
438	0.38
439	0.28
440	0.24
441	0.17
442	0.16
443	0.2
444	0.25
445	0.27
446	0.3
447	0.35
448	0.4
449	0.42
450	0.47
451	0.47
452	0.53
453	0.52
454	0.55
455	0.56
456	0.56
457	0.6
458	0.62
459	0.65
460	0.63
461	0.67
462	0.65
463	0.64
464	0.59
465	0.61
466	0.57
467	0.52
468	0.5
469	0.48
470	0.49
471	0.54
472	0.6
473	0.59
474	0.59
475	0.58
476	0.54
477	0.54
478	0.53
479	0.47
480	0.42
481	0.36
482	0.36
483	0.36
484	0.32
485	0.31
486	0.28
487	0.25
488	0.24
489	0.24
490	0.22
491	0.24
492	0.32
493	0.33
494	0.37
495	0.43

A0A4U0TPA0

3D AlphaFold-predicted Structure Viewer