Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A4U0U1Q3

Protein Details
Accession A0A4U0U1Q3    Localization Confidence High Confidence Score 17
NoLS Segment(s)
PositionSequenceProtein Nature
129-168AGIGRRPPRRTKEQREYDQAMRIQEKKKRDQAKAEEEKKVBasic
NLS Segment(s)
PositionSequence
131-143IGRRPPRRTKEQR
150-174RIQEKKKRDQAKAEEEKKVAERQKA
Subcellular Location(s) nucl 21, mito 3, cyto 3, cyto_mito 3
Family & Domain DBs
Amino Acid Sequences MAALASSLDKLSISDSSKASPKQKRTDPAEFWEDEADTEPDSGTASPLQQVSSSDYPGAPPPTPASPSFSSSKTMEGSPYQTFPPYGMGGPLQDRHSGTGSSLAQRAAGGGEEKRPEKSTAVASRLIAAGIGRRPPRRTKEQREYDQAMRIQEKKKRDQAKAEEEKKVAERQKAKAAIWDD
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.19
2 0.2
3 0.23
4 0.3
5 0.36
6 0.43
7 0.47
8 0.53
9 0.59
10 0.66
11 0.72
12 0.74
13 0.78
14 0.73
15 0.71
16 0.68
17 0.59
18 0.52
19 0.44
20 0.36
21 0.27
22 0.24
23 0.19
24 0.13
25 0.12
26 0.11
27 0.09
28 0.1
29 0.09
30 0.08
31 0.08
32 0.07
33 0.09
34 0.1
35 0.1
36 0.1
37 0.11
38 0.16
39 0.17
40 0.17
41 0.16
42 0.15
43 0.16
44 0.19
45 0.21
46 0.15
47 0.14
48 0.16
49 0.17
50 0.2
51 0.2
52 0.22
53 0.21
54 0.24
55 0.25
56 0.24
57 0.26
58 0.24
59 0.25
60 0.21
61 0.19
62 0.17
63 0.16
64 0.19
65 0.16
66 0.17
67 0.16
68 0.15
69 0.14
70 0.13
71 0.14
72 0.11
73 0.09
74 0.08
75 0.08
76 0.08
77 0.1
78 0.11
79 0.11
80 0.11
81 0.11
82 0.12
83 0.13
84 0.13
85 0.12
86 0.14
87 0.14
88 0.14
89 0.15
90 0.13
91 0.12
92 0.12
93 0.12
94 0.07
95 0.07
96 0.07
97 0.06
98 0.1
99 0.13
100 0.14
101 0.16
102 0.18
103 0.19
104 0.19
105 0.21
106 0.26
107 0.28
108 0.3
109 0.3
110 0.28
111 0.28
112 0.27
113 0.24
114 0.16
115 0.1
116 0.1
117 0.11
118 0.17
119 0.21
120 0.26
121 0.31
122 0.39
123 0.46
124 0.55
125 0.63
126 0.68
127 0.74
128 0.8
129 0.83
130 0.83
131 0.82
132 0.75
133 0.71
134 0.63
135 0.57
136 0.52
137 0.5
138 0.49
139 0.49
140 0.53
141 0.55
142 0.62
143 0.67
144 0.69
145 0.73
146 0.75
147 0.8
148 0.83
149 0.8
150 0.78
151 0.69
152 0.66
153 0.6
154 0.59
155 0.54
156 0.52
157 0.53
158 0.52
159 0.6
160 0.62
161 0.59