Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A4U0TK47

Protein Details
Accession A0A4U0TK47   
Localization Confidence Medium
Confidence Score 14.4
NoLS Segment(s)
PositionSequenceProtein Nature
26-67GKGLDKKSVRTPKTQKKPERKPTSTKDKVVKKRPAKKPTTLHBasic
NLS Segment(s)
PositionSequence
20-64ESKTAKGKGLDKKSVRTPKTQKKPERKPTSTKDKVVKKRPAKKPT
Subcellular Location(s) nucl 25, cyto_nucl 14
Family & Domain DBs
Amino Acid Sequences MAPKTRSKTTTYREVKPNPESKTAKGKGLDKKSVRTPKTQKKPERKPTSTKDKVVKKRPAKKPTTLHAKPTKQEAPATPEQQEITDLILRQLSFMSDFYTSSWATHIYSDRVRTSISEACMALKEMRTVKKFRIPSPTWYPSPCGRKSISSTSEFAHS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.71
2 0.73
3 0.72
4 0.74
5 0.68
6 0.7
7 0.66
8 0.61
9 0.65
10 0.59
11 0.56
12 0.53
13 0.56
14 0.56
15 0.61
16 0.66
17 0.59
18 0.62
19 0.66
20 0.71
21 0.66
22 0.67
23 0.69
24 0.7
25 0.77
26 0.82
27 0.82
28 0.83
29 0.91
30 0.92
31 0.92
32 0.88
33 0.86
34 0.85
35 0.86
36 0.83
37 0.79
38 0.76
39 0.76
40 0.79
41 0.79
42 0.8
43 0.79
44 0.82
45 0.85
46 0.86
47 0.82
48 0.81
49 0.78
50 0.77
51 0.78
52 0.69
53 0.68
54 0.67
55 0.66
56 0.58
57 0.58
58 0.53
59 0.44
60 0.43
61 0.36
62 0.34
63 0.35
64 0.35
65 0.29
66 0.26
67 0.25
68 0.22
69 0.21
70 0.14
71 0.1
72 0.1
73 0.09
74 0.08
75 0.09
76 0.09
77 0.09
78 0.08
79 0.07
80 0.07
81 0.07
82 0.08
83 0.07
84 0.08
85 0.08
86 0.11
87 0.11
88 0.1
89 0.1
90 0.1
91 0.1
92 0.12
93 0.13
94 0.14
95 0.17
96 0.21
97 0.21
98 0.21
99 0.21
100 0.19
101 0.22
102 0.23
103 0.21
104 0.2
105 0.19
106 0.19
107 0.2
108 0.2
109 0.18
110 0.14
111 0.17
112 0.2
113 0.27
114 0.31
115 0.34
116 0.38
117 0.45
118 0.49
119 0.5
120 0.55
121 0.51
122 0.55
123 0.62
124 0.63
125 0.59
126 0.56
127 0.56
128 0.54
129 0.59
130 0.54
131 0.49
132 0.45
133 0.47
134 0.51
135 0.56
136 0.53
137 0.49
138 0.48