Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A4U0TLS6

Protein Details
Accession A0A4U0TLS6    Localization Confidence Medium Confidence Score 13.5
NoLS Segment(s)
PositionSequenceProtein Nature
177-207SESSRSTSRRAAKKTKRAKDVPYDERHKRKWBasic
NLS Segment(s)
PositionSequence
182-196STSRRAAKKTKRAKD
Subcellular Location(s) nucl 21.5, cyto_nucl 14, cyto 3.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR024526  DUF3807  
Pfam View protein in Pfam  
PF12720  DUF3807  
Amino Acid Sequences MAQRQAHQAKKAAHPQAGERSGVTLMPQPPRKAPTPVITEADLLAFQYAHFGDDSKPDHWFVDAETALNLQSAYTVAEDSELGCYPDGAKRTLTDEQIEIFRHSEIQELLRERRRQREEQELDEREPEQDRVAETRQPPLASDASSLEAEHVGLATPAVKQTLHPSPKRQPSQSSRSESSRSTSRRAAKKTKRAKDVPYDERHKRKWEDFIEDNDPVQGSLTFRRVVRQLDDKQDEPVVMDY
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.55
2 0.56
3 0.59
4 0.55
5 0.47
6 0.38
7 0.33
8 0.3
9 0.28
10 0.23
11 0.19
12 0.21
13 0.29
14 0.35
15 0.36
16 0.41
17 0.45
18 0.48
19 0.47
20 0.48
21 0.47
22 0.48
23 0.5
24 0.47
25 0.44
26 0.41
27 0.34
28 0.3
29 0.21
30 0.14
31 0.1
32 0.07
33 0.06
34 0.07
35 0.07
36 0.07
37 0.07
38 0.08
39 0.09
40 0.15
41 0.19
42 0.17
43 0.19
44 0.19
45 0.2
46 0.19
47 0.19
48 0.14
49 0.17
50 0.16
51 0.14
52 0.13
53 0.13
54 0.12
55 0.12
56 0.11
57 0.05
58 0.05
59 0.05
60 0.05
61 0.05
62 0.05
63 0.05
64 0.05
65 0.05
66 0.06
67 0.07
68 0.07
69 0.07
70 0.07
71 0.07
72 0.07
73 0.1
74 0.11
75 0.11
76 0.11
77 0.11
78 0.16
79 0.2
80 0.2
81 0.19
82 0.18
83 0.18
84 0.2
85 0.2
86 0.16
87 0.14
88 0.12
89 0.12
90 0.11
91 0.12
92 0.1
93 0.11
94 0.13
95 0.15
96 0.2
97 0.26
98 0.32
99 0.33
100 0.42
101 0.46
102 0.48
103 0.5
104 0.56
105 0.53
106 0.53
107 0.59
108 0.52
109 0.47
110 0.42
111 0.38
112 0.28
113 0.26
114 0.2
115 0.12
116 0.1
117 0.1
118 0.12
119 0.13
120 0.17
121 0.16
122 0.2
123 0.21
124 0.2
125 0.2
126 0.2
127 0.19
128 0.15
129 0.16
130 0.13
131 0.13
132 0.13
133 0.12
134 0.09
135 0.08
136 0.08
137 0.07
138 0.06
139 0.04
140 0.03
141 0.03
142 0.04
143 0.04
144 0.04
145 0.05
146 0.05
147 0.06
148 0.11
149 0.21
150 0.28
151 0.31
152 0.39
153 0.47
154 0.57
155 0.63
156 0.62
157 0.62
158 0.63
159 0.68
160 0.69
161 0.68
162 0.62
163 0.61
164 0.6
165 0.52
166 0.48
167 0.48
168 0.43
169 0.41
170 0.44
171 0.48
172 0.54
173 0.61
174 0.67
175 0.69
176 0.76
177 0.82
178 0.83
179 0.84
180 0.82
181 0.82
182 0.81
183 0.81
184 0.8
185 0.79
186 0.78
187 0.78
188 0.81
189 0.79
190 0.77
191 0.74
192 0.7
193 0.7
194 0.68
195 0.67
196 0.62
197 0.63
198 0.61
199 0.55
200 0.49
201 0.41
202 0.34
203 0.26
204 0.22
205 0.16
206 0.12
207 0.15
208 0.19
209 0.21
210 0.21
211 0.26
212 0.29
213 0.32
214 0.36
215 0.42
216 0.46
217 0.53
218 0.59
219 0.55
220 0.54
221 0.52
222 0.45