FuNGI

A0A4U0TKL8

Protein Details

Accession

A0A4U0TKL8

Localization Confidence

Low

Confidence Score

9.7

NoLS Segment(s)

Position	Sequence	Protein Nature
366-385	KCLARHPSPAQRQQHKKETL	Hydrophilic

NLS Segment(s)

Position	Sequence
285-285	R

Subcellular Location(s)

nucl 8, mito 8, cyto 8, cyto_nucl 8, cyto_mito 8, mito_nucl 8

Family & Domain DBs

InterPro	View protein in InterPro IPR040366 Nab2/ZC3H14 IPR043094 Nab2/ZC3H14_N_sf IPR000571 Znf_CCCH
Gene Ontology	GO:0005634 C:nucleus GO:0046872 F:metal ion binding GO:0008143 F:poly(A) binding GO:1900364 P:negative regulation of mRNA polyadenylation GO:0043488 P:regulation of mRNA stability
Pfam	View protein in Pfam PF14608 zf-CCCH_2
PROSITE	View protein in PROSITE PS50103 ZF_C3H1

Amino Acid Sequences

MAGISIEAGSALAQTIQNAAQAKLMDAGWAAEENDTTLSEYVTMMLVNGKDFQSVQSELGGELLGVGEDDPTVADFTRWLFEHANAVARPQQTQGEPDLGATTQEPSMQVDGQGQNMQDQAMADDAAPPGDDVPSGPKAMRNGDPASRGRGRGGRMLGQITRSMDRSSDDPLRRIKGAASGGVGRIDAHAARPPRGPRGGTLASGVQRTMNGRPGAAVAQMNPMMQQGAQMVGSDPNMQMQFMQMMEMQAQMMAQFMGNGQPPKPGGFQSGGRGGKPIADRLGGRRGGGSFQGRVKKEGDGEGNAMSLDKPLSDSKPAFDTMCKFNHMCTIDTCPFAHQSPANTRPHITLDMSDTCMYGAACTNNKCLARHPSPAQRQQHKKETLCKFFPNCSYGAACPFRHPDQPPCRNGGDCKVEGCPFAHSTIMCRYDPCTRGVCAYKHAEGQKRGKYEDKVWKANGGADGANHLAGGEPMDHAAAGKSDRFAELFKEGDGMDEELILPGQNGDAAATGGQNGGPAASSAPGGDAGQEGMPQVAS

FASTA Sequence
with NoLS information

AlphaFold Structure
with highlighted NoLS

NoLS Predictions per Residue

Residue Number	Score
1	0.07
2	0.09
3	0.1
4	0.13
5	0.15
6	0.15
7	0.17
8	0.17
9	0.17
10	0.18
11	0.17
12	0.14
13	0.12
14	0.12
15	0.1
16	0.11
17	0.11
18	0.09
19	0.09
20	0.09
21	0.1
22	0.1
23	0.11
24	0.1
25	0.1
26	0.1
27	0.1
28	0.09
29	0.09
30	0.08
31	0.06
32	0.09
33	0.1
34	0.1
35	0.13
36	0.12
37	0.13
38	0.14
39	0.15
40	0.17
41	0.18
42	0.18
43	0.17
44	0.17
45	0.16
46	0.16
47	0.14
48	0.09
49	0.07
50	0.06
51	0.04
52	0.04
53	0.04
54	0.04
55	0.03
56	0.04
57	0.04
58	0.05
59	0.06
60	0.06
61	0.06
62	0.07
63	0.08
64	0.12
65	0.13
66	0.15
67	0.16
68	0.17
69	0.22
70	0.23
71	0.27
72	0.23
73	0.25
74	0.27
75	0.26
76	0.26
77	0.24
78	0.26
79	0.21
80	0.24
81	0.25
82	0.23
83	0.22
84	0.21
85	0.2
86	0.16
87	0.16
88	0.13
89	0.12
90	0.09
91	0.1
92	0.1
93	0.11
94	0.13
95	0.12
96	0.12
97	0.17
98	0.17
99	0.18
100	0.2
101	0.18
102	0.18
103	0.18
104	0.17
105	0.12
106	0.11
107	0.09
108	0.08
109	0.08
110	0.07
111	0.08
112	0.08
113	0.07
114	0.07
115	0.07
116	0.06
117	0.06
118	0.06
119	0.05
120	0.1
121	0.11
122	0.12
123	0.13
124	0.15
125	0.17
126	0.22
127	0.25
128	0.25
129	0.27
130	0.3
131	0.35
132	0.34
133	0.39
134	0.38
135	0.35
136	0.34
137	0.35
138	0.34
139	0.34
140	0.35
141	0.33
142	0.32
143	0.34
144	0.32
145	0.29
146	0.29
147	0.26
148	0.25
149	0.21
150	0.19
151	0.17
152	0.17
153	0.17
154	0.19
155	0.26
156	0.26
157	0.29
158	0.33
159	0.36
160	0.35
161	0.34
162	0.29
163	0.26
164	0.26
165	0.22
166	0.19
167	0.17
168	0.17
169	0.17
170	0.16
171	0.1
172	0.09
173	0.09
174	0.07
175	0.07
176	0.11
177	0.13
178	0.15
179	0.19
180	0.22
181	0.26
182	0.3
183	0.29
184	0.26
185	0.33
186	0.32
187	0.28
188	0.27
189	0.24
190	0.22
191	0.22
192	0.21
193	0.13
194	0.12
195	0.14
196	0.14
197	0.18
198	0.16
199	0.16
200	0.16
201	0.16
202	0.16
203	0.15
204	0.14
205	0.08
206	0.11
207	0.11
208	0.11
209	0.1
210	0.09
211	0.08
212	0.07
213	0.07
214	0.05
215	0.05
216	0.05
217	0.05
218	0.06
219	0.06
220	0.07
221	0.07
222	0.07
223	0.09
224	0.09
225	0.09
226	0.08
227	0.08
228	0.08
229	0.07
230	0.08
231	0.06
232	0.06
233	0.06
234	0.06
235	0.06
236	0.05
237	0.05
238	0.04
239	0.04
240	0.03
241	0.03
242	0.03
243	0.03
244	0.05
245	0.07
246	0.08
247	0.08
248	0.1
249	0.1
250	0.12
251	0.13
252	0.12
253	0.12
254	0.14
255	0.15
256	0.16
257	0.23
258	0.22
259	0.21
260	0.21
261	0.19
262	0.2
263	0.2
264	0.19
265	0.12
266	0.13
267	0.14
268	0.16
269	0.23
270	0.19
271	0.19
272	0.18
273	0.17
274	0.17
275	0.2
276	0.18
277	0.14
278	0.19
279	0.25
280	0.25
281	0.27
282	0.27
283	0.25
284	0.25
285	0.26
286	0.23
287	0.18
288	0.19
289	0.17
290	0.15
291	0.14
292	0.12
293	0.09
294	0.07
295	0.06
296	0.04
297	0.06
298	0.08
299	0.09
300	0.13
301	0.14
302	0.15
303	0.17
304	0.18
305	0.17
306	0.17
307	0.19
308	0.19
309	0.21
310	0.23
311	0.21
312	0.2
313	0.26
314	0.25
315	0.23
316	0.2
317	0.26
318	0.25
319	0.27
320	0.26
321	0.21
322	0.22
323	0.21
324	0.22
325	0.16
326	0.18
327	0.25
328	0.32
329	0.34
330	0.34
331	0.34
332	0.33
333	0.34
334	0.32
335	0.25
336	0.19
337	0.2
338	0.2
339	0.22
340	0.2
341	0.17
342	0.15
343	0.15
344	0.13
345	0.09
346	0.09
347	0.1
348	0.14
349	0.15
350	0.18
351	0.22
352	0.24
353	0.24
354	0.27
355	0.33
356	0.34
357	0.4
358	0.44
359	0.49
360	0.56
361	0.65
362	0.69
363	0.7
364	0.76
365	0.77
366	0.81
367	0.79
368	0.76
369	0.76
370	0.76
371	0.75
372	0.7
373	0.69
374	0.62
375	0.59
376	0.58
377	0.5
378	0.42
379	0.35
380	0.33
381	0.27
382	0.3
383	0.3
384	0.26
385	0.28
386	0.32
387	0.33
388	0.37
389	0.4
390	0.43
391	0.49
392	0.57
393	0.57
394	0.57
395	0.56
396	0.52
397	0.52
398	0.49
399	0.46
400	0.38
401	0.36
402	0.34
403	0.33
404	0.32
405	0.29
406	0.25
407	0.19
408	0.19
409	0.19
410	0.16
411	0.18
412	0.24
413	0.28
414	0.24
415	0.24
416	0.26
417	0.32
418	0.34
419	0.34
420	0.3
421	0.27
422	0.32
423	0.37
424	0.36
425	0.34
426	0.37
427	0.36
428	0.4
429	0.46
430	0.48
431	0.51
432	0.58
433	0.59
434	0.58
435	0.59
436	0.6
437	0.58
438	0.59
439	0.62
440	0.61
441	0.62
442	0.59
443	0.59
444	0.53
445	0.51
446	0.44
447	0.35
448	0.27
449	0.2
450	0.21
451	0.18
452	0.17
453	0.13
454	0.1
455	0.08
456	0.07
457	0.08
458	0.06
459	0.06
460	0.06
461	0.07
462	0.06
463	0.07
464	0.07
465	0.08
466	0.1
467	0.11
468	0.12
469	0.13
470	0.14
471	0.15
472	0.15
473	0.17
474	0.19
475	0.18
476	0.17
477	0.18
478	0.16
479	0.17
480	0.18
481	0.15
482	0.12
483	0.11
484	0.11
485	0.1
486	0.1
487	0.09
488	0.07
489	0.05
490	0.05
491	0.06
492	0.05
493	0.05
494	0.06
495	0.06
496	0.06
497	0.06
498	0.07
499	0.07
500	0.07
501	0.07
502	0.06
503	0.06
504	0.06
505	0.06
506	0.06
507	0.07
508	0.07
509	0.07
510	0.08
511	0.09
512	0.08
513	0.09
514	0.08
515	0.09
516	0.09
517	0.1
518	0.09

A0A4U0TKL8

3D AlphaFold-predicted Structure Viewer