Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A4U0TLW5

Protein Details
Accession A0A4U0TLW5    Localization Confidence Low Confidence Score 9.7
NoLS Segment(s)
PositionSequenceProtein Nature
37-68ARNPNEKRGKREDKRKKKKRKEKLAFLWLQRABasic
NLS Segment(s)
PositionSequence
42-59EKRGKREDKRKKKKRKEK
Subcellular Location(s) mito 18, mito_nucl 13.833, cyto_mito 9.833, nucl 8.5
Family & Domain DBs
Amino Acid Sequences MPRKHPEKPPSPRMTPQRSDAKCRVVVCGLGLFEDFARNPNEKRGKREDKRKKKKRKEKLAFLWLQRAKNSSALGQLDDPV
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.8
2 0.73
3 0.71
4 0.71
5 0.66
6 0.67
7 0.64
8 0.6
9 0.56
10 0.52
11 0.47
12 0.38
13 0.34
14 0.27
15 0.23
16 0.16
17 0.12
18 0.11
19 0.09
20 0.07
21 0.08
22 0.07
23 0.07
24 0.1
25 0.11
26 0.12
27 0.2
28 0.29
29 0.31
30 0.37
31 0.46
32 0.54
33 0.61
34 0.72
35 0.75
36 0.77
37 0.86
38 0.91
39 0.92
40 0.93
41 0.96
42 0.95
43 0.96
44 0.95
45 0.94
46 0.94
47 0.93
48 0.88
49 0.81
50 0.8
51 0.73
52 0.66
53 0.57
54 0.49
55 0.41
56 0.38
57 0.36
58 0.28
59 0.29
60 0.27
61 0.28