Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A4U0TJX1

Protein Details
Accession A0A4U0TJX1    Localization Confidence Medium Confidence Score 10.7
NoLS Segment(s)
PositionSequenceProtein Nature
5-35RWTVRERESFARHRRRRRRSCREGVWDCRGVBasic
NLS Segment(s)
PositionSequence
15-23ARHRRRRRR
Subcellular Location(s) mito 13, nucl 7, cyto 6
Family & Domain DBs
Amino Acid Sequences MGPGRWTVRERESFARHRRRRRRSCREGVWDCRGVGTGSRSTGKEGKLAAADANAMTIDRPKGMRDKGLLSYAAANQCNRPSTSPVQYGAALYTVQLGVLLLEEV
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.67
2 0.73
3 0.74
4 0.79
5 0.85
6 0.88
7 0.91
8 0.93
9 0.94
10 0.93
11 0.94
12 0.93
13 0.92
14 0.9
15 0.86
16 0.82
17 0.73
18 0.62
19 0.52
20 0.43
21 0.32
22 0.25
23 0.21
24 0.15
25 0.15
26 0.17
27 0.17
28 0.2
29 0.23
30 0.21
31 0.2
32 0.19
33 0.18
34 0.16
35 0.16
36 0.13
37 0.1
38 0.09
39 0.06
40 0.06
41 0.05
42 0.04
43 0.03
44 0.05
45 0.05
46 0.06
47 0.07
48 0.08
49 0.14
50 0.15
51 0.19
52 0.2
53 0.23
54 0.24
55 0.26
56 0.25
57 0.2
58 0.21
59 0.21
60 0.23
61 0.21
62 0.19
63 0.2
64 0.22
65 0.24
66 0.24
67 0.23
68 0.25
69 0.29
70 0.35
71 0.36
72 0.35
73 0.35
74 0.34
75 0.32
76 0.27
77 0.22
78 0.15
79 0.11
80 0.11
81 0.08
82 0.07
83 0.07
84 0.06
85 0.05