Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A4U0TXR0

Protein Details
Accession A0A4U0TXR0   
Localization Confidence Low
Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
45-69RTTSAVQRCKRERNRVRMRKPLYSPHydrophilic
NLS Segment(s)
PositionSequence
56-74ERNRVRMRKPLYSPARGER
Subcellular Location(s) cyto 18, mito 5, pero 2
Family & Domain DBs
Amino Acid Sequences MQEDDTGDVCVYGIVSAILYTVHPPATASVVKHAVAIDEFRLARRTTSAVQRCKRERNRVRMRKPLYSPARGERTKGRASWRLCVV
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.04
2 0.04
3 0.04
4 0.04
5 0.04
6 0.04
7 0.05
8 0.06
9 0.07
10 0.07
11 0.07
12 0.08
13 0.11
14 0.12
15 0.12
16 0.14
17 0.16
18 0.17
19 0.17
20 0.16
21 0.13
22 0.12
23 0.12
24 0.08
25 0.09
26 0.09
27 0.09
28 0.11
29 0.11
30 0.11
31 0.11
32 0.13
33 0.14
34 0.23
35 0.31
36 0.38
37 0.43
38 0.51
39 0.56
40 0.64
41 0.7
42 0.72
43 0.73
44 0.75
45 0.82
46 0.84
47 0.87
48 0.87
49 0.85
50 0.82
51 0.78
52 0.77
53 0.74
54 0.7
55 0.66
56 0.64
57 0.67
58 0.59
59 0.58
60 0.56
61 0.55
62 0.55
63 0.54
64 0.54
65 0.52
66 0.55