Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A4U0TLG8

Protein Details
Accession A0A4U0TLG8    Localization Confidence Medium Confidence Score 14.2
NoLS Segment(s)
PositionSequenceProtein Nature
1-50MDRERDHRRDERRPTGPRDSKSHLPERSRSRSPKRRDDRRSPPRGPTRRGBasic
NLS Segment(s)
PositionSequence
7-63HRRDERRPTGPRDSKSHLPERSRSRSPKRRDDRRSPPRGPTRRGGAGGSGGGNNRAP
Subcellular Location(s) nucl 24.5, cyto_nucl 15
Family & Domain DBs
InterPro View protein in InterPro  
IPR013957  SNRNP27  
Gene Ontology GO:0005634  C:nucleus  
GO:0006397  P:mRNA processing  
GO:0008380  P:RNA splicing  
Pfam View protein in Pfam  
PF08648  SNRNP27  
Amino Acid Sequences MDRERDHRRDERRPTGPRDSKSHLPERSRSRSPKRRDDRRSPPRGPTRRGGAGGSGGGNNRAPNPSYRERDYRRQPTHSPPPPSAPRATNPNASRAPRGPASSHPRGSGPKVIAQDVHMEGLEGEDEETTMKRIMGFQGFRSTKNTKVPGNDKNYAVNKVKKAEYRQYMNRVGGFNRPLSPSRG
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.81
2 0.83
3 0.82
4 0.78
5 0.75
6 0.72
7 0.71
8 0.71
9 0.72
10 0.68
11 0.66
12 0.69
13 0.71
14 0.72
15 0.72
16 0.75
17 0.77
18 0.79
19 0.82
20 0.84
21 0.86
22 0.88
23 0.89
24 0.89
25 0.9
26 0.91
27 0.91
28 0.86
29 0.85
30 0.85
31 0.84
32 0.78
33 0.73
34 0.7
35 0.64
36 0.61
37 0.51
38 0.41
39 0.34
40 0.3
41 0.24
42 0.18
43 0.13
44 0.12
45 0.12
46 0.12
47 0.11
48 0.12
49 0.12
50 0.14
51 0.21
52 0.27
53 0.31
54 0.35
55 0.43
56 0.48
57 0.56
58 0.63
59 0.67
60 0.65
61 0.66
62 0.66
63 0.66
64 0.71
65 0.69
66 0.64
67 0.55
68 0.57
69 0.55
70 0.53
71 0.47
72 0.39
73 0.34
74 0.36
75 0.37
76 0.37
77 0.33
78 0.36
79 0.37
80 0.36
81 0.36
82 0.31
83 0.31
84 0.26
85 0.27
86 0.23
87 0.26
88 0.33
89 0.36
90 0.36
91 0.34
92 0.34
93 0.35
94 0.36
95 0.33
96 0.27
97 0.25
98 0.25
99 0.25
100 0.23
101 0.21
102 0.21
103 0.17
104 0.16
105 0.11
106 0.1
107 0.09
108 0.09
109 0.08
110 0.05
111 0.04
112 0.03
113 0.04
114 0.04
115 0.05
116 0.06
117 0.06
118 0.07
119 0.07
120 0.08
121 0.11
122 0.17
123 0.18
124 0.19
125 0.29
126 0.3
127 0.31
128 0.37
129 0.37
130 0.36
131 0.43
132 0.46
133 0.4
134 0.47
135 0.54
136 0.57
137 0.62
138 0.61
139 0.54
140 0.57
141 0.57
142 0.56
143 0.55
144 0.53
145 0.5
146 0.51
147 0.55
148 0.54
149 0.58
150 0.61
151 0.62
152 0.64
153 0.68
154 0.7
155 0.71
156 0.68
157 0.64
158 0.57
159 0.5
160 0.49
161 0.44
162 0.39
163 0.36
164 0.37