Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A4U0TLC2

Protein Details
Accession A0A4U0TLC2   
Localization Confidence High
Confidence Score 19.5
NoLS Segment(s)
PositionSequenceProtein Nature
19-40RGKGEGKKPKKVGKGEKETKTTBasic
55-80AGIAKGEKKKKVKKGKKSGKNSTEEEBasic
NLS Segment(s)
PositionSequence
19-40RGKGEGKKPKKVGKGEKETKTT
43-47MRPKK
56-74GIAKGEKKKKVKKGKKSGK
Subcellular Location(s) nucl 20, cyto_nucl 12.5, mito 4
Family & Domain DBs
Amino Acid Sequences MTLFISLRDQDSVEALYSRGKGEGKKPKKVGKGEKETKTTVTMRPKKNTETDGDAGIAKGEKKKKVKKGKKSGKNSTEEEADTSVTQEKPLRKGRAEELRDESRKGARSRNTSLDRLYIRPTG
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.13
2 0.12
3 0.14
4 0.14
5 0.14
6 0.15
7 0.16
8 0.19
9 0.28
10 0.39
11 0.44
12 0.52
13 0.59
14 0.65
15 0.71
16 0.78
17 0.79
18 0.78
19 0.81
20 0.81
21 0.8
22 0.77
23 0.7
24 0.62
25 0.56
26 0.48
27 0.44
28 0.45
29 0.47
30 0.5
31 0.55
32 0.57
33 0.56
34 0.58
35 0.54
36 0.47
37 0.44
38 0.38
39 0.32
40 0.29
41 0.25
42 0.2
43 0.17
44 0.14
45 0.08
46 0.12
47 0.16
48 0.21
49 0.3
50 0.38
51 0.48
52 0.59
53 0.68
54 0.74
55 0.81
56 0.86
57 0.88
58 0.9
59 0.9
60 0.87
61 0.83
62 0.75
63 0.67
64 0.59
65 0.49
66 0.4
67 0.3
68 0.23
69 0.17
70 0.15
71 0.15
72 0.12
73 0.14
74 0.17
75 0.19
76 0.26
77 0.35
78 0.4
79 0.39
80 0.43
81 0.5
82 0.56
83 0.56
84 0.54
85 0.52
86 0.56
87 0.56
88 0.54
89 0.48
90 0.44
91 0.47
92 0.45
93 0.46
94 0.45
95 0.51
96 0.56
97 0.63
98 0.63
99 0.6
100 0.6
101 0.59
102 0.54
103 0.49