FuNGI

A0A4U0U3C7

Protein Details

Accession

A0A4U0U3C7

Localization Confidence

Medium

Confidence Score

14.8

NoLS Segment(s)

Position	Sequence	Protein Nature
15-45	NAPATTPKPGEQKKSRPRKRGPNYSQIHAKP	Hydrophilic

NLS Segment(s)

Position	Sequence
22-35	KPGEQKKSRPRKRG
138-145	ERAKRRGG
160-174	REERRLFKLERARAE

Subcellular Location(s)

cyto 10.5, cyto_nucl 10.5, nucl 9.5, mito 4

Family & Domain DBs

InterPro	View protein in InterPro IPR011856 tRNA_endonuc-like_dom_sf IPR036167 tRNA_intron_Endo_cat-like_sf IPR006677 tRNA_intron_Endonuc_cat-like IPR006676 tRNA_splic IPR016589 tRNA_splic_SEN2
Gene Ontology	GO:0000214 C:tRNA-intron endonuclease complex GO:0016829 F:lyase activity GO:0003676 F:nucleic acid binding GO:0000213 F:tRNA-intron endonuclease activity GO:0006388 P:tRNA splicing, via endonucleolytic cleavage and ligation
Pfam	View protein in Pfam PF01974 tRNA_int_endo
CDD	cd22363 tRNA-intron_lyase_C

Amino Acid Sequences

MANGHTTPKPGAQDNAPATTPKPGEQKKSRPRKRGPNYSQIHAKPLPLQIHPLPAFHPSHPLSLLHLCYVYLTQLISPPSSHPDTLYTGYYSPETRSVHVTDSKSIRALWEMGFFGKGNLSRSEPSWLEREKARVLAERAKRRGGGVGGGTAEEATMARREERRLFKLERARAERERIERQRAVEEGRMSVEEFERLEAGDAAPSSDQTPAEFTDDVQKSPQQTTHPEPRVPDADLINPTTAEPDKPALPGVTVTAPCGTVVPPEVPEIEEPEPEPNIPNQEHLQLTLEEAFFLSASLGILHIHNPGPPNPIALTPSTLLHTFTQTPLSPTAALEPDNPFLLTYTTYHHFRTLNWVVRPGTKFSCDYLLYAHGPVFSHAEFAVIILPAYTDPYWRTPEGLLKRRGVKAGESEGRDWWWLHCVNRVQSQVRKSLVLCYVDVPAPEVLRKAMAEEGWKGVLRRYKVREFVVRRWLANRSRD

FASTA Sequence
with NoLS information

AlphaFold Structure
with highlighted NoLS

NoLS Predictions per Residue

Residue Number	Score
1	0.41
2	0.43
3	0.4
4	0.36
5	0.34
6	0.37
7	0.35
8	0.31
9	0.38
10	0.41
11	0.5
12	0.59
13	0.69
14	0.72
15	0.82
16	0.87
17	0.87
18	0.91
19	0.92
20	0.93
21	0.93
22	0.91
23	0.9
24	0.86
25	0.83
26	0.82
27	0.73
28	0.7
29	0.6
30	0.54
31	0.48
32	0.5
33	0.46
34	0.37
35	0.42
36	0.36
37	0.43
38	0.42
39	0.38
40	0.32
41	0.33
42	0.35
43	0.3
44	0.36
45	0.28
46	0.3
47	0.3
48	0.29
49	0.28
50	0.3
51	0.3
52	0.24
53	0.22
54	0.19
55	0.18
56	0.18
57	0.14
58	0.1
59	0.09
60	0.08
61	0.12
62	0.13
63	0.13
64	0.14
65	0.15
66	0.2
67	0.23
68	0.23
69	0.2
70	0.22
71	0.25
72	0.27
73	0.27
74	0.22
75	0.2
76	0.21
77	0.22
78	0.19
79	0.17
80	0.21
81	0.21
82	0.21
83	0.25
84	0.25
85	0.28
86	0.33
87	0.34
88	0.34
89	0.35
90	0.35
91	0.33
92	0.31
93	0.27
94	0.23
95	0.23
96	0.17
97	0.17
98	0.16
99	0.15
100	0.16
101	0.15
102	0.14
103	0.15
104	0.15
105	0.15
106	0.17
107	0.19
108	0.19
109	0.21
110	0.26
111	0.24
112	0.24
113	0.28
114	0.27
115	0.27
116	0.28
117	0.32
118	0.28
119	0.31
120	0.31
121	0.3
122	0.32
123	0.39
124	0.45
125	0.5
126	0.51
127	0.51
128	0.49
129	0.45
130	0.44
131	0.36
132	0.31
133	0.22
134	0.2
135	0.17
136	0.16
137	0.15
138	0.11
139	0.1
140	0.06
141	0.05
142	0.04
143	0.06
144	0.06
145	0.1
146	0.12
147	0.17
148	0.24
149	0.32
150	0.35
151	0.41
152	0.43
153	0.48
154	0.55
155	0.57
156	0.58
157	0.57
158	0.59
159	0.56
160	0.59
161	0.57
162	0.54
163	0.58
164	0.56
165	0.57
166	0.53
167	0.51
168	0.48
169	0.44
170	0.41
171	0.35
172	0.29
173	0.23
174	0.21
175	0.19
176	0.16
177	0.16
178	0.13
179	0.1
180	0.09
181	0.09
182	0.08
183	0.07
184	0.08
185	0.07
186	0.06
187	0.06
188	0.06
189	0.06
190	0.06
191	0.06
192	0.06
193	0.07
194	0.07
195	0.06
196	0.08
197	0.08
198	0.11
199	0.1
200	0.1
201	0.18
202	0.19
203	0.19
204	0.19
205	0.2
206	0.19
207	0.2
208	0.23
209	0.16
210	0.21
211	0.26
212	0.35
213	0.38
214	0.37
215	0.37
216	0.38
217	0.37
218	0.33
219	0.29
220	0.2
221	0.19
222	0.19
223	0.19
224	0.15
225	0.13
226	0.12
227	0.12
228	0.11
229	0.08
230	0.08
231	0.09
232	0.09
233	0.09
234	0.1
235	0.08
236	0.08
237	0.08
238	0.08
239	0.09
240	0.09
241	0.09
242	0.09
243	0.09
244	0.08
245	0.09
246	0.08
247	0.06
248	0.07
249	0.07
250	0.07
251	0.08
252	0.08
253	0.08
254	0.09
255	0.12
256	0.12
257	0.12
258	0.11
259	0.12
260	0.12
261	0.12
262	0.13
263	0.1
264	0.13
265	0.13
266	0.15
267	0.15
268	0.17
269	0.17
270	0.17
271	0.17
272	0.13
273	0.14
274	0.14
275	0.12
276	0.09
277	0.09
278	0.08
279	0.06
280	0.06
281	0.05
282	0.03
283	0.03
284	0.03
285	0.04
286	0.04
287	0.05
288	0.05
289	0.07
290	0.07
291	0.09
292	0.11
293	0.12
294	0.15
295	0.15
296	0.16
297	0.15
298	0.16
299	0.16
300	0.15
301	0.16
302	0.13
303	0.13
304	0.13
305	0.13
306	0.14
307	0.13
308	0.15
309	0.14
310	0.14
311	0.17
312	0.16
313	0.18
314	0.17
315	0.18
316	0.16
317	0.15
318	0.17
319	0.14
320	0.15
321	0.15
322	0.16
323	0.16
324	0.16
325	0.16
326	0.13
327	0.12
328	0.12
329	0.11
330	0.09
331	0.12
332	0.16
333	0.18
334	0.19
335	0.22
336	0.22
337	0.21
338	0.3
339	0.34
340	0.38
341	0.37
342	0.41
343	0.39
344	0.45
345	0.47
346	0.42
347	0.37
348	0.32
349	0.32
350	0.29
351	0.33
352	0.27
353	0.25
354	0.23
355	0.23
356	0.21
357	0.21
358	0.2
359	0.16
360	0.15
361	0.16
362	0.16
363	0.12
364	0.12
365	0.11
366	0.11
367	0.1
368	0.1
369	0.1
370	0.07
371	0.07
372	0.06
373	0.06
374	0.05
375	0.09
376	0.08
377	0.09
378	0.11
379	0.15
380	0.2
381	0.2
382	0.22
383	0.22
384	0.31
385	0.39
386	0.46
387	0.48
388	0.5
389	0.57
390	0.58
391	0.6
392	0.53
393	0.47
394	0.44
395	0.48
396	0.48
397	0.44
398	0.42
399	0.4
400	0.4
401	0.37
402	0.32
403	0.23
404	0.23
405	0.23
406	0.23
407	0.29
408	0.34
409	0.38
410	0.45
411	0.5
412	0.51
413	0.54
414	0.57
415	0.57
416	0.53
417	0.5
418	0.44
419	0.44
420	0.43
421	0.39
422	0.35
423	0.29
424	0.3
425	0.28
426	0.28
427	0.23
428	0.19
429	0.18
430	0.18
431	0.18
432	0.15
433	0.16
434	0.16
435	0.15
436	0.17
437	0.17
438	0.2
439	0.21
440	0.23
441	0.24
442	0.26
443	0.25
444	0.27
445	0.32
446	0.34
447	0.41
448	0.46
449	0.52
450	0.57
451	0.64
452	0.69
453	0.7
454	0.73
455	0.75
456	0.71
457	0.65
458	0.63
459	0.65

A0A4U0U3C7

3D AlphaFold-predicted Structure Viewer