Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A4U0U4Q9

Protein Details
Accession A0A4U0U4Q9    Localization Confidence High Confidence Score 16.9
NoLS Segment(s)
PositionSequenceProtein Nature
72-99ARPECKPESMRKTKAKKVVKRIAAKPDSHydrophilic
NLS Segment(s)
PositionSequence
47-68PSRRPVRQAAKKANEKRQGWVK
73-74RP
76-96CKPESMRKTKAKKVVKRIAAK
Subcellular Location(s) nucl 16.5, cyto_nucl 10, mito 7
Family & Domain DBs
Amino Acid Sequences MATEISIRSNNDLKNDLDVMKASIILLELCKTGEQDENLHILRRSMPSRRPVRQAAKKANEKRQGWVKDLLARPECKPESMRKTKAKKVVKRIAAKPDSL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.3
2 0.31
3 0.27
4 0.22
5 0.21
6 0.18
7 0.15
8 0.15
9 0.1
10 0.08
11 0.08
12 0.07
13 0.07
14 0.06
15 0.06
16 0.07
17 0.07
18 0.07
19 0.08
20 0.11
21 0.11
22 0.12
23 0.14
24 0.17
25 0.17
26 0.18
27 0.17
28 0.14
29 0.16
30 0.18
31 0.2
32 0.21
33 0.26
34 0.33
35 0.41
36 0.45
37 0.48
38 0.52
39 0.59
40 0.62
41 0.66
42 0.67
43 0.68
44 0.74
45 0.77
46 0.78
47 0.78
48 0.7
49 0.67
50 0.66
51 0.61
52 0.55
53 0.52
54 0.45
55 0.43
56 0.45
57 0.46
58 0.41
59 0.4
60 0.38
61 0.42
62 0.4
63 0.35
64 0.36
65 0.39
66 0.45
67 0.52
68 0.6
69 0.62
70 0.7
71 0.75
72 0.82
73 0.82
74 0.81
75 0.83
76 0.84
77 0.83
78 0.84
79 0.83
80 0.84