Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A4S4L2J3

Protein Details
Accession A0A4S4L2J3   
Localization Confidence Low
Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
78-108VRERRDLRTLRERRPPRPHHRDRRGLSPRERBasic
NLS Segment(s)
PositionSequence
79-109VRERRDLRTLRERRPPRPHHRDRRGLSPRER
Subcellular Location(s) plas 25
Family & Domain DBs
InterPro View protein in InterPro  
IPR045018  Azg-like  
IPR006043  NCS2  
Gene Ontology GO:0016020  C:membrane  
GO:0015205  F:nucleobase transmembrane transporter activity  
GO:1904823  P:purine nucleobase transmembrane transport  
Pfam View protein in Pfam  
PF00860  Xan_ur_permease  
Amino Acid Sequences MITYIDRINARVAASAAGRWFRLEGSGHPRQRAGSRFLTEIRAGLTTWAAMAYIISVNASIISDSGGPCECPVSSXRPVRERRDLRTLRERRPPRPHHRDRRGLSPRERAHGPVCEYPGGTSAGARPECFAYSVVGFHGSGKTTYQEALAAVFLEGWVFFILSLLGVRQWLARAMPHSLVMAVGTGIGLFIARVMQNPTTWLGIFVGGMLTVFLMLYRIRGSILVGIFLVSIISWPRDSAVTYFPHNSSGDDLFAFFKQVVTFRPLKLTGLAIDWSSYSSGRVWYALITFLYVDILDTTGTLYSMAKFAGLRDPVTLDFENSTVAYCVDAFSISMGALMGTSPVTAFVESATGISEGGKTGITGVVVGIMFFVSVFFAPIFASIPPWATGGALVIVGSLMIRNVREINWDYVGDSIPAFLTLILIPLTYKYVYTT
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.18
2 0.19
3 0.2
4 0.2
5 0.2
6 0.19
7 0.19
8 0.17
9 0.2
10 0.19
11 0.22
12 0.29
13 0.38
14 0.42
15 0.44
16 0.45
17 0.45
18 0.5
19 0.49
20 0.47
21 0.45
22 0.44
23 0.45
24 0.46
25 0.48
26 0.41
27 0.36
28 0.31
29 0.24
30 0.2
31 0.17
32 0.15
33 0.11
34 0.1
35 0.09
36 0.07
37 0.06
38 0.06
39 0.06
40 0.06
41 0.06
42 0.06
43 0.06
44 0.06
45 0.06
46 0.06
47 0.05
48 0.05
49 0.06
50 0.07
51 0.07
52 0.09
53 0.1
54 0.1
55 0.1
56 0.11
57 0.1
58 0.11
59 0.13
60 0.2
61 0.25
62 0.33
63 0.43
64 0.51
65 0.57
66 0.64
67 0.7
68 0.68
69 0.74
70 0.71
71 0.69
72 0.71
73 0.74
74 0.73
75 0.76
76 0.77
77 0.76
78 0.82
79 0.84
80 0.84
81 0.87
82 0.9
83 0.9
84 0.93
85 0.93
86 0.86
87 0.86
88 0.85
89 0.83
90 0.79
91 0.78
92 0.72
93 0.67
94 0.64
95 0.56
96 0.51
97 0.48
98 0.44
99 0.39
100 0.37
101 0.33
102 0.31
103 0.28
104 0.26
105 0.21
106 0.17
107 0.13
108 0.12
109 0.18
110 0.18
111 0.18
112 0.17
113 0.17
114 0.17
115 0.18
116 0.16
117 0.11
118 0.11
119 0.11
120 0.11
121 0.11
122 0.1
123 0.1
124 0.11
125 0.1
126 0.1
127 0.1
128 0.11
129 0.11
130 0.11
131 0.1
132 0.1
133 0.09
134 0.09
135 0.08
136 0.07
137 0.06
138 0.06
139 0.05
140 0.04
141 0.04
142 0.04
143 0.04
144 0.03
145 0.03
146 0.03
147 0.04
148 0.04
149 0.04
150 0.03
151 0.03
152 0.04
153 0.04
154 0.04
155 0.05
156 0.06
157 0.06
158 0.07
159 0.09
160 0.11
161 0.12
162 0.12
163 0.11
164 0.11
165 0.1
166 0.09
167 0.07
168 0.04
169 0.04
170 0.03
171 0.03
172 0.02
173 0.02
174 0.02
175 0.02
176 0.02
177 0.03
178 0.03
179 0.04
180 0.07
181 0.07
182 0.08
183 0.09
184 0.1
185 0.1
186 0.1
187 0.1
188 0.08
189 0.08
190 0.07
191 0.06
192 0.05
193 0.04
194 0.04
195 0.03
196 0.02
197 0.02
198 0.02
199 0.02
200 0.03
201 0.03
202 0.04
203 0.04
204 0.05
205 0.05
206 0.05
207 0.06
208 0.08
209 0.08
210 0.08
211 0.07
212 0.07
213 0.07
214 0.06
215 0.06
216 0.03
217 0.03
218 0.03
219 0.04
220 0.04
221 0.04
222 0.05
223 0.06
224 0.07
225 0.08
226 0.11
227 0.13
228 0.15
229 0.17
230 0.17
231 0.19
232 0.19
233 0.18
234 0.17
235 0.15
236 0.14
237 0.12
238 0.12
239 0.11
240 0.1
241 0.1
242 0.08
243 0.08
244 0.08
245 0.09
246 0.1
247 0.14
248 0.16
249 0.16
250 0.2
251 0.2
252 0.2
253 0.2
254 0.19
255 0.15
256 0.14
257 0.14
258 0.1
259 0.1
260 0.09
261 0.08
262 0.08
263 0.08
264 0.07
265 0.07
266 0.08
267 0.09
268 0.09
269 0.09
270 0.08
271 0.09
272 0.09
273 0.09
274 0.08
275 0.07
276 0.07
277 0.07
278 0.06
279 0.05
280 0.04
281 0.05
282 0.04
283 0.04
284 0.04
285 0.04
286 0.04
287 0.05
288 0.05
289 0.05
290 0.06
291 0.06
292 0.07
293 0.07
294 0.08
295 0.13
296 0.14
297 0.14
298 0.15
299 0.17
300 0.17
301 0.21
302 0.2
303 0.15
304 0.15
305 0.14
306 0.15
307 0.13
308 0.13
309 0.08
310 0.08
311 0.07
312 0.07
313 0.07
314 0.06
315 0.06
316 0.05
317 0.05
318 0.06
319 0.05
320 0.05
321 0.05
322 0.04
323 0.04
324 0.04
325 0.04
326 0.04
327 0.04
328 0.03
329 0.04
330 0.05
331 0.05
332 0.06
333 0.05
334 0.06
335 0.06
336 0.06
337 0.07
338 0.06
339 0.06
340 0.07
341 0.07
342 0.06
343 0.07
344 0.07
345 0.06
346 0.06
347 0.07
348 0.07
349 0.06
350 0.06
351 0.07
352 0.07
353 0.07
354 0.06
355 0.05
356 0.05
357 0.05
358 0.05
359 0.04
360 0.04
361 0.05
362 0.05
363 0.06
364 0.06
365 0.07
366 0.08
367 0.07
368 0.09
369 0.09
370 0.11
371 0.11
372 0.12
373 0.12
374 0.11
375 0.11
376 0.09
377 0.09
378 0.07
379 0.06
380 0.05
381 0.05
382 0.05
383 0.05
384 0.04
385 0.04
386 0.06
387 0.07
388 0.09
389 0.11
390 0.12
391 0.18
392 0.22
393 0.26
394 0.27
395 0.27
396 0.26
397 0.26
398 0.26
399 0.21
400 0.16
401 0.12
402 0.09
403 0.09
404 0.09
405 0.07
406 0.08
407 0.07
408 0.08
409 0.08
410 0.08
411 0.08
412 0.09
413 0.12
414 0.1