Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A4S4LEU5

Protein Details
Accession A0A4S4LEU5    Localization Confidence Medium Confidence Score 11.8
NoLS Segment(s)
PositionSequenceProtein Nature
15-41VSLRQTRVRARVRPDRRRPLNAPNTLSHydrophilic
NLS Segment(s)
PositionSequence
159-164RERTKH
Subcellular Location(s) mito 12, nucl 10, cyto 4
Family & Domain DBs
Amino Acid Sequences MSTLDGRQRAECGVVSLRQTRVRARVRPDRRRPLNAPNTLSSYSTPLSTILKMNNGKKGPPQAPPKYLNDFSKALANEVRILLQEVGQLRDERRQLQYEIAELMAVKSKHGAGGEYTPDWRPPVAPEAIAPPPPPPAVDEGALTPAKPAWRTVVKHDRRERTKHKAPAAPPQIAAAPAPAPTPQMPAWAQWKPNPLLTPQPRMGSAPSPGPAPAPKPADGLFGPRTPPPK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.23
2 0.26
3 0.29
4 0.33
5 0.36
6 0.39
7 0.4
8 0.46
9 0.52
10 0.55
11 0.59
12 0.65
13 0.71
14 0.79
15 0.84
16 0.85
17 0.85
18 0.87
19 0.84
20 0.84
21 0.84
22 0.81
23 0.75
24 0.67
25 0.63
26 0.56
27 0.51
28 0.41
29 0.35
30 0.27
31 0.22
32 0.19
33 0.16
34 0.16
35 0.16
36 0.18
37 0.16
38 0.23
39 0.29
40 0.32
41 0.39
42 0.38
43 0.38
44 0.4
45 0.48
46 0.44
47 0.46
48 0.52
49 0.51
50 0.57
51 0.6
52 0.6
53 0.58
54 0.59
55 0.53
56 0.48
57 0.42
58 0.36
59 0.37
60 0.32
61 0.26
62 0.23
63 0.21
64 0.18
65 0.17
66 0.16
67 0.11
68 0.13
69 0.11
70 0.09
71 0.11
72 0.1
73 0.11
74 0.12
75 0.13
76 0.13
77 0.17
78 0.19
79 0.19
80 0.22
81 0.23
82 0.23
83 0.25
84 0.24
85 0.2
86 0.19
87 0.16
88 0.13
89 0.1
90 0.09
91 0.1
92 0.09
93 0.08
94 0.08
95 0.08
96 0.09
97 0.1
98 0.1
99 0.07
100 0.09
101 0.11
102 0.11
103 0.12
104 0.11
105 0.12
106 0.12
107 0.11
108 0.09
109 0.09
110 0.12
111 0.12
112 0.11
113 0.11
114 0.15
115 0.16
116 0.17
117 0.16
118 0.12
119 0.14
120 0.14
121 0.13
122 0.1
123 0.12
124 0.13
125 0.13
126 0.13
127 0.11
128 0.15
129 0.15
130 0.13
131 0.1
132 0.1
133 0.11
134 0.11
135 0.12
136 0.13
137 0.2
138 0.22
139 0.32
140 0.41
141 0.47
142 0.57
143 0.65
144 0.7
145 0.7
146 0.78
147 0.78
148 0.77
149 0.79
150 0.77
151 0.77
152 0.74
153 0.7
154 0.71
155 0.69
156 0.6
157 0.51
158 0.44
159 0.37
160 0.3
161 0.27
162 0.17
163 0.11
164 0.09
165 0.1
166 0.09
167 0.11
168 0.11
169 0.15
170 0.14
171 0.18
172 0.18
173 0.21
174 0.27
175 0.29
176 0.32
177 0.32
178 0.39
179 0.37
180 0.41
181 0.39
182 0.36
183 0.42
184 0.45
185 0.48
186 0.45
187 0.45
188 0.42
189 0.42
190 0.43
191 0.35
192 0.32
193 0.29
194 0.26
195 0.25
196 0.24
197 0.25
198 0.25
199 0.24
200 0.29
201 0.29
202 0.29
203 0.31
204 0.32
205 0.34
206 0.31
207 0.34
208 0.31
209 0.3
210 0.31