Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A4S4K5U3

Protein Details
Accession A0A4S4K5U3    Localization Confidence High Confidence Score 15.9
NoLS Segment(s)
PositionSequenceProtein Nature
68-92ARAVKKGASRTPKKQEERRTRGRLGBasic
NLS Segment(s)
PositionSequence
32-35KKAK
57-93SRSSRSGKAPTARAVKKGASRTPKXKQEERRTRGRLG
Subcellular Location(s) nucl 22.5, cyto_nucl 13, cyto 2.5
Family & Domain DBs
Amino Acid Sequences MSSGATSGGEGGESQMDGEDDGGPSTPLEKPKKAKTKREMTDEEYARQLSSELNGRSRSSRSGKAPTARAVKKGASRTPKXKQEERRTRGRLGGLATTVRR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.06
2 0.06
3 0.06
4 0.06
5 0.07
6 0.06
7 0.06
8 0.07
9 0.07
10 0.07
11 0.06
12 0.08
13 0.1
14 0.18
15 0.22
16 0.28
17 0.34
18 0.44
19 0.55
20 0.62
21 0.69
22 0.71
23 0.77
24 0.77
25 0.79
26 0.74
27 0.69
28 0.69
29 0.6
30 0.52
31 0.43
32 0.37
33 0.28
34 0.23
35 0.18
36 0.09
37 0.09
38 0.13
39 0.12
40 0.15
41 0.16
42 0.17
43 0.19
44 0.21
45 0.25
46 0.25
47 0.3
48 0.32
49 0.37
50 0.42
51 0.45
52 0.47
53 0.48
54 0.53
55 0.49
56 0.47
57 0.44
58 0.42
59 0.43
60 0.46
61 0.47
62 0.48
63 0.54
64 0.61
65 0.68
66 0.74
67 0.77
68 0.8
69 0.84
70 0.85
71 0.86
72 0.87
73 0.85
74 0.79
75 0.75
76 0.7
77 0.63
78 0.55
79 0.5
80 0.42