Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

E2LTJ0

Protein Details
Accession E2LTJ0   
Localization Confidence Low
Confidence Score 8.9
NoLS Segment(s)
PositionSequenceProtein Nature
10-30TFDSKTKKITFRSQKNCNYESHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 12.5, mito 11, cyto_nucl 8.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR000270  PB1_dom  
KEGG mpr:MPER_10414  -  
Pfam View protein in Pfam  
PF00564  PB1  
PROSITE View protein in PROSITE  
PS51745  PB1  
Amino Acid Sequences MSSRLVLYCTFDSKTKKITFRSQKNCNYESLRARVEESFSLRASSYIISYTDDDREITNISSDRDLHEAIEYFQAGEDNQSVSSGTSMLSVRSGRKITLRFDITVEGPSLSDGGSILTLDEDEYRDRNGSHSSFSFGAPSMDLDDDAAT
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.42
2 0.45
3 0.49
4 0.52
5 0.61
6 0.66
7 0.71
8 0.78
9 0.79
10 0.81
11 0.82
12 0.77
13 0.72
14 0.67
15 0.64
16 0.6
17 0.56
18 0.48
19 0.41
20 0.42
21 0.37
22 0.34
23 0.29
24 0.27
25 0.24
26 0.22
27 0.22
28 0.2
29 0.19
30 0.17
31 0.14
32 0.11
33 0.09
34 0.09
35 0.1
36 0.11
37 0.13
38 0.13
39 0.13
40 0.13
41 0.12
42 0.12
43 0.11
44 0.1
45 0.11
46 0.1
47 0.11
48 0.11
49 0.11
50 0.12
51 0.12
52 0.12
53 0.11
54 0.11
55 0.1
56 0.1
57 0.1
58 0.09
59 0.07
60 0.07
61 0.06
62 0.05
63 0.06
64 0.05
65 0.05
66 0.05
67 0.05
68 0.05
69 0.05
70 0.05
71 0.05
72 0.05
73 0.06
74 0.06
75 0.06
76 0.08
77 0.09
78 0.11
79 0.15
80 0.15
81 0.15
82 0.2
83 0.23
84 0.25
85 0.31
86 0.32
87 0.29
88 0.29
89 0.3
90 0.26
91 0.24
92 0.21
93 0.14
94 0.11
95 0.1
96 0.09
97 0.07
98 0.06
99 0.05
100 0.04
101 0.04
102 0.04
103 0.04
104 0.04
105 0.04
106 0.05
107 0.06
108 0.07
109 0.09
110 0.1
111 0.12
112 0.13
113 0.13
114 0.15
115 0.2
116 0.2
117 0.23
118 0.23
119 0.26
120 0.26
121 0.26
122 0.25
123 0.2
124 0.19
125 0.15
126 0.15
127 0.13
128 0.13
129 0.13