Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A4S4K5Z0

Protein Details
Accession A0A4S4K5Z0   
Localization Confidence Medium
Confidence Score 12.4
NoLS Segment(s)
PositionSequenceProtein Nature
6-29TAERHESKKKSAVRTRKEQLQVNGHydrophilic
276-295ASQSKKKRARDAKRLEAKVKBasic
NLS Segment(s)
PositionSequence
280-293KKKRARDAKRLEAK
Subcellular Location(s) cyto_nucl 10, nucl 9, mito 9, cyto 9
Family & Domain DBs
InterPro View protein in InterPro  
IPR038765  Papain-like_cys_pep_sf  
IPR001394  Peptidase_C19_UCH  
IPR018200  USP_CS  
IPR028889  USP_dom  
Gene Ontology GO:0004843  F:cysteine-type deubiquitinase activity  
GO:0016579  P:protein deubiquitination  
GO:0006511  P:ubiquitin-dependent protein catabolic process  
Pfam View protein in Pfam  
PF00443  UCH  
PROSITE View protein in PROSITE  
PS00973  USP_2  
PS50235  USP_3  
CDD cd02662  Peptidase_C19F  
Amino Acid Sequences GEAGATAERHESKKKSAVRTRKEQLQVNGSAIYSDLEEEDDSDLYYPGLVNVSGTYCFLNSVLQAMASLAYLQPHVDAIHARAVDLDVPTPVVDALQETLRTLNIPRSSRSSFRPIPMINALSQPVPGKRSKLFASREHQDAQELFQLLSECLKAESLAIAHEGLRDHGLGAFARARVSEGAEVGAGVFDGLTANRRSCVECGYTEAVMHFAFDNWTLSLPRAAAVCALQDCLADYIRLELLTDCICRKCSMLATLERLHLEADRLKEAVVGDVAASQSKKKRARDAKRLEAKVKAAIDEGRIEEDIKGVRLEKVFSKASTKQAMVARPPKILVLHLNRSVHYGGYGGAGRNSCRVMFPEILDLTPYTTSGQLSTSPSVPISAPPPLIPRSTTPTQSLYATPHVLYRLSAVVCHYGMHSFGHYVCFRRKPRTAGSGAGSSVPTTPKMACPYGCECAECVAYGHVRDGHPPTPGRGWLRTSDDSVEECGLERVLGEGAGAFLLFYERVVQPR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.55
2 0.61
3 0.67
4 0.74
5 0.76
6 0.82
7 0.84
8 0.84
9 0.84
10 0.81
11 0.78
12 0.75
13 0.68
14 0.6
15 0.53
16 0.43
17 0.35
18 0.28
19 0.21
20 0.13
21 0.11
22 0.08
23 0.08
24 0.08
25 0.09
26 0.1
27 0.1
28 0.1
29 0.1
30 0.1
31 0.09
32 0.09
33 0.08
34 0.07
35 0.08
36 0.07
37 0.07
38 0.08
39 0.09
40 0.1
41 0.11
42 0.11
43 0.1
44 0.1
45 0.1
46 0.1
47 0.09
48 0.1
49 0.09
50 0.09
51 0.09
52 0.08
53 0.08
54 0.07
55 0.07
56 0.06
57 0.07
58 0.07
59 0.07
60 0.07
61 0.08
62 0.08
63 0.09
64 0.1
65 0.11
66 0.16
67 0.16
68 0.15
69 0.15
70 0.15
71 0.16
72 0.15
73 0.14
74 0.09
75 0.09
76 0.09
77 0.09
78 0.08
79 0.06
80 0.06
81 0.06
82 0.07
83 0.09
84 0.09
85 0.09
86 0.1
87 0.1
88 0.11
89 0.12
90 0.17
91 0.22
92 0.25
93 0.27
94 0.33
95 0.38
96 0.41
97 0.45
98 0.47
99 0.45
100 0.46
101 0.51
102 0.44
103 0.45
104 0.46
105 0.42
106 0.34
107 0.32
108 0.29
109 0.22
110 0.23
111 0.2
112 0.18
113 0.2
114 0.21
115 0.23
116 0.24
117 0.28
118 0.31
119 0.37
120 0.4
121 0.44
122 0.49
123 0.5
124 0.52
125 0.49
126 0.45
127 0.4
128 0.35
129 0.29
130 0.26
131 0.22
132 0.18
133 0.17
134 0.17
135 0.14
136 0.15
137 0.13
138 0.08
139 0.08
140 0.08
141 0.07
142 0.06
143 0.07
144 0.06
145 0.06
146 0.07
147 0.07
148 0.07
149 0.08
150 0.08
151 0.08
152 0.09
153 0.08
154 0.08
155 0.08
156 0.09
157 0.07
158 0.09
159 0.1
160 0.1
161 0.1
162 0.1
163 0.11
164 0.1
165 0.11
166 0.1
167 0.08
168 0.08
169 0.08
170 0.08
171 0.06
172 0.06
173 0.04
174 0.03
175 0.02
176 0.02
177 0.02
178 0.03
179 0.06
180 0.07
181 0.08
182 0.09
183 0.1
184 0.12
185 0.13
186 0.16
187 0.15
188 0.14
189 0.18
190 0.19
191 0.18
192 0.17
193 0.16
194 0.14
195 0.12
196 0.12
197 0.08
198 0.06
199 0.06
200 0.06
201 0.07
202 0.06
203 0.07
204 0.07
205 0.08
206 0.08
207 0.08
208 0.08
209 0.08
210 0.07
211 0.07
212 0.07
213 0.07
214 0.07
215 0.07
216 0.06
217 0.06
218 0.06
219 0.07
220 0.07
221 0.06
222 0.05
223 0.06
224 0.06
225 0.06
226 0.06
227 0.05
228 0.06
229 0.07
230 0.08
231 0.08
232 0.09
233 0.1
234 0.1
235 0.11
236 0.11
237 0.11
238 0.13
239 0.16
240 0.18
241 0.22
242 0.23
243 0.23
244 0.22
245 0.21
246 0.18
247 0.14
248 0.13
249 0.12
250 0.11
251 0.11
252 0.11
253 0.11
254 0.12
255 0.11
256 0.1
257 0.08
258 0.06
259 0.05
260 0.06
261 0.06
262 0.06
263 0.06
264 0.08
265 0.12
266 0.21
267 0.27
268 0.3
269 0.4
270 0.5
271 0.6
272 0.69
273 0.74
274 0.76
275 0.8
276 0.81
277 0.73
278 0.66
279 0.58
280 0.51
281 0.42
282 0.32
283 0.24
284 0.2
285 0.19
286 0.16
287 0.15
288 0.12
289 0.12
290 0.12
291 0.1
292 0.11
293 0.1
294 0.09
295 0.09
296 0.09
297 0.11
298 0.11
299 0.12
300 0.13
301 0.17
302 0.18
303 0.19
304 0.24
305 0.25
306 0.3
307 0.33
308 0.31
309 0.31
310 0.34
311 0.36
312 0.38
313 0.41
314 0.38
315 0.35
316 0.35
317 0.31
318 0.27
319 0.26
320 0.26
321 0.26
322 0.3
323 0.34
324 0.35
325 0.34
326 0.36
327 0.34
328 0.26
329 0.2
330 0.14
331 0.09
332 0.1
333 0.11
334 0.09
335 0.11
336 0.12
337 0.12
338 0.14
339 0.15
340 0.13
341 0.12
342 0.14
343 0.17
344 0.17
345 0.18
346 0.21
347 0.21
348 0.21
349 0.2
350 0.18
351 0.15
352 0.13
353 0.13
354 0.08
355 0.09
356 0.09
357 0.09
358 0.1
359 0.11
360 0.14
361 0.15
362 0.15
363 0.15
364 0.15
365 0.16
366 0.15
367 0.14
368 0.14
369 0.15
370 0.15
371 0.15
372 0.19
373 0.2
374 0.21
375 0.21
376 0.22
377 0.26
378 0.3
379 0.31
380 0.31
381 0.32
382 0.32
383 0.32
384 0.31
385 0.27
386 0.27
387 0.26
388 0.23
389 0.22
390 0.21
391 0.2
392 0.18
393 0.16
394 0.16
395 0.14
396 0.15
397 0.14
398 0.16
399 0.16
400 0.16
401 0.15
402 0.12
403 0.12
404 0.13
405 0.12
406 0.11
407 0.11
408 0.17
409 0.18
410 0.22
411 0.28
412 0.37
413 0.41
414 0.49
415 0.54
416 0.56
417 0.62
418 0.66
419 0.63
420 0.59
421 0.57
422 0.52
423 0.46
424 0.41
425 0.33
426 0.25
427 0.23
428 0.19
429 0.16
430 0.15
431 0.16
432 0.19
433 0.24
434 0.27
435 0.26
436 0.3
437 0.34
438 0.38
439 0.38
440 0.33
441 0.29
442 0.28
443 0.28
444 0.23
445 0.18
446 0.16
447 0.17
448 0.17
449 0.19
450 0.21
451 0.21
452 0.26
453 0.3
454 0.29
455 0.33
456 0.34
457 0.35
458 0.35
459 0.42
460 0.42
461 0.41
462 0.42
463 0.43
464 0.49
465 0.47
466 0.46
467 0.42
468 0.4
469 0.37
470 0.36
471 0.3
472 0.23
473 0.2
474 0.18
475 0.15
476 0.12
477 0.1
478 0.09
479 0.08
480 0.08
481 0.07
482 0.06
483 0.06
484 0.06
485 0.06
486 0.04
487 0.04
488 0.06
489 0.06
490 0.06
491 0.1