Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A4S4KGK6

Protein Details
Accession A0A4S4KGK6    Localization Confidence High Confidence Score 16.5
NoLS Segment(s)
PositionSequenceProtein Nature
28-47GLERIPKKFHKYRKVFEKEABasic
NLS Segment(s)
PositionSequence
25-55EKGGLERIPKKFHKYRKVFEKEASERLPARK
Subcellular Location(s) nucl 23, cyto 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR043502  DNA/RNA_pol_sf  
IPR032567  LDOC1-rel  
CDD cd01647  RT_LTR  
Amino Acid Sequences MDASDEVYDERYDWKIREREVRGMEKGGLERIPKKFHKYRKVFEKEASERLPARKPWDHEIKLKPDFVQKRAKIYNLSPDEQQELDAWLEENLRKGYIRPSKSPMTSPVFFVDKKDKSKRMVTDNRYLNSGTIKNAYPLPLISEIIDKVRGAKYFSKLDLRWGYNNVRIKEGDEEKXCFCN
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.28
2 0.32
3 0.37
4 0.46
5 0.48
6 0.54
7 0.58
8 0.63
9 0.57
10 0.54
11 0.5
12 0.44
13 0.4
14 0.34
15 0.29
16 0.27
17 0.3
18 0.32
19 0.39
20 0.41
21 0.48
22 0.54
23 0.61
24 0.68
25 0.71
26 0.75
27 0.78
28 0.82
29 0.77
30 0.74
31 0.75
32 0.69
33 0.67
34 0.59
35 0.52
36 0.47
37 0.47
38 0.47
39 0.39
40 0.42
41 0.4
42 0.42
43 0.46
44 0.52
45 0.52
46 0.54
47 0.58
48 0.59
49 0.57
50 0.54
51 0.47
52 0.46
53 0.46
54 0.44
55 0.47
56 0.41
57 0.45
58 0.46
59 0.47
60 0.41
61 0.39
62 0.43
63 0.37
64 0.37
65 0.3
66 0.29
67 0.29
68 0.25
69 0.24
70 0.14
71 0.11
72 0.1
73 0.09
74 0.08
75 0.06
76 0.07
77 0.07
78 0.08
79 0.07
80 0.08
81 0.08
82 0.08
83 0.17
84 0.24
85 0.27
86 0.29
87 0.34
88 0.38
89 0.4
90 0.41
91 0.39
92 0.37
93 0.34
94 0.32
95 0.3
96 0.28
97 0.27
98 0.28
99 0.31
100 0.29
101 0.37
102 0.43
103 0.45
104 0.47
105 0.54
106 0.56
107 0.58
108 0.63
109 0.61
110 0.62
111 0.64
112 0.6
113 0.55
114 0.5
115 0.4
116 0.35
117 0.3
118 0.23
119 0.19
120 0.19
121 0.19
122 0.2
123 0.2
124 0.16
125 0.15
126 0.16
127 0.15
128 0.15
129 0.14
130 0.15
131 0.15
132 0.16
133 0.17
134 0.13
135 0.15
136 0.18
137 0.18
138 0.21
139 0.25
140 0.29
141 0.33
142 0.37
143 0.42
144 0.39
145 0.47
146 0.51
147 0.5
148 0.48
149 0.49
150 0.5
151 0.49
152 0.57
153 0.49
154 0.45
155 0.41
156 0.4
157 0.43
158 0.46
159 0.46
160 0.43