Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A4S4LCF4

Protein Details
Accession A0A4S4LCF4   
Localization Confidence Low
Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
205-229GAGTIVKKKSTKRRRLTDRLEVTTAHydrophilic
NLS Segment(s)
PositionSequence
213-219KKSTKRR
Subcellular Location(s) cyto 12, mito 6, extr 4, mito_nucl 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR036770  Ankyrin_rpt-contain_sf  
Amino Acid Sequences MHTTSGLERLPAELICEIQLFALNETLPVVNKWTQGIFSSTLSYYRAQYILQRFLCPLGPQRHRKGVVTFALQFPICTEDVLGVVLRISSSFSRFSAGQPPMLPSPSSDTYTXKTHDYTPDPNAHEGYALSRAVHAGFRPLVKFLLHHGATPKLKNALAVRIAIKKRDFALVRALIEREVDDVSADEHLNDGNVGKAGGDGGVGVGAGTIVKKKSTKRRRLTDRLEVTTAMLRTAVEVDARDIVEYFRGKGARPDILTLQHLAAGGLM
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.13
2 0.14
3 0.14
4 0.12
5 0.1
6 0.14
7 0.12
8 0.13
9 0.13
10 0.12
11 0.12
12 0.13
13 0.14
14 0.11
15 0.11
16 0.14
17 0.15
18 0.16
19 0.18
20 0.17
21 0.18
22 0.19
23 0.21
24 0.19
25 0.18
26 0.19
27 0.18
28 0.19
29 0.2
30 0.19
31 0.18
32 0.18
33 0.17
34 0.15
35 0.22
36 0.27
37 0.33
38 0.33
39 0.33
40 0.31
41 0.32
42 0.33
43 0.29
44 0.31
45 0.32
46 0.39
47 0.46
48 0.53
49 0.6
50 0.6
51 0.61
52 0.56
53 0.54
54 0.5
55 0.46
56 0.42
57 0.34
58 0.34
59 0.31
60 0.27
61 0.21
62 0.19
63 0.14
64 0.12
65 0.11
66 0.08
67 0.08
68 0.09
69 0.08
70 0.05
71 0.05
72 0.04
73 0.04
74 0.04
75 0.06
76 0.06
77 0.08
78 0.1
79 0.1
80 0.13
81 0.13
82 0.15
83 0.21
84 0.22
85 0.22
86 0.21
87 0.23
88 0.22
89 0.23
90 0.21
91 0.14
92 0.19
93 0.19
94 0.21
95 0.19
96 0.2
97 0.21
98 0.26
99 0.27
100 0.22
101 0.22
102 0.22
103 0.25
104 0.27
105 0.29
106 0.3
107 0.3
108 0.3
109 0.29
110 0.25
111 0.22
112 0.17
113 0.14
114 0.11
115 0.09
116 0.08
117 0.07
118 0.08
119 0.08
120 0.08
121 0.07
122 0.07
123 0.08
124 0.09
125 0.1
126 0.1
127 0.1
128 0.1
129 0.11
130 0.11
131 0.17
132 0.17
133 0.17
134 0.18
135 0.23
136 0.26
137 0.26
138 0.25
139 0.2
140 0.2
141 0.22
142 0.22
143 0.2
144 0.19
145 0.21
146 0.21
147 0.26
148 0.27
149 0.28
150 0.28
151 0.25
152 0.25
153 0.3
154 0.28
155 0.22
156 0.29
157 0.28
158 0.29
159 0.28
160 0.27
161 0.21
162 0.2
163 0.19
164 0.12
165 0.09
166 0.08
167 0.06
168 0.06
169 0.07
170 0.08
171 0.07
172 0.06
173 0.06
174 0.06
175 0.06
176 0.06
177 0.05
178 0.05
179 0.05
180 0.05
181 0.05
182 0.05
183 0.05
184 0.04
185 0.04
186 0.03
187 0.03
188 0.03
189 0.03
190 0.03
191 0.02
192 0.02
193 0.03
194 0.03
195 0.06
196 0.07
197 0.1
198 0.15
199 0.23
200 0.35
201 0.46
202 0.56
203 0.64
204 0.75
205 0.82
206 0.89
207 0.9
208 0.89
209 0.87
210 0.82
211 0.74
212 0.63
213 0.54
214 0.48
215 0.39
216 0.29
217 0.2
218 0.14
219 0.13
220 0.14
221 0.12
222 0.09
223 0.09
224 0.11
225 0.13
226 0.13
227 0.13
228 0.12
229 0.12
230 0.16
231 0.16
232 0.16
233 0.19
234 0.2
235 0.2
236 0.27
237 0.31
238 0.33
239 0.34
240 0.36
241 0.35
242 0.39
243 0.4
244 0.35
245 0.3
246 0.25
247 0.23