Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A4S4LCV4

Protein Details
Accession A0A4S4LCV4   
Localization Confidence High
Confidence Score 17.6
NoLS Segment(s)
PositionSequenceProtein Nature
202-228EYLDKEKKNKSERARRKKEDTARLRTLBasic
290-322EEKANAKKEKERLANEKKKARRAAKKAEENGAAHydrophilic
NLS Segment(s)
PositionSequence
208-221XKKNKSERARRKKE
239-317RIKRIKQEEKEAREAKKRKGKPGASSAADAERKRLEEEAEKMRQEEEAERQKEEKANAKKEKERLANEKKKARRAAKKA
Subcellular Location(s) nucl 14, mito 6, cyto 5
Family & Domain DBs
InterPro View protein in InterPro  
IPR036869  J_dom_sf  
IPR044634  Zuotin/DnaJC2  
Gene Ontology GO:0030544  F:Hsp70 protein binding  
GO:0043022  F:ribosome binding  
GO:0051083  P:'de novo' cotranslational protein folding  
GO:0006450  P:regulation of translational fidelity  
Amino Acid Sequences MVSVISLPLLAPPLPATWSQEQGASGKTIAPLVQRTLLPVGSAYIAHVRRSIHNHSFEEHDKAEAERRQREESEGVEGIEDDLGVGEEEEPENLLTLDPKEWKCIQKAHEVLSHSEKRRQFDSVDPHFMELEEEAPHASDAKRHVDHDPKEFFTLFGSVFERESRFSKNQPVPMLGAMNDPKDSVEGFYNFWYNFDSWRSFEYLDKEXKKNKSERARRKKEDTARLRTLVDLALSLDPRIKRIKQEEKEAREAKKRKGKPGASSAADAERKRLEEEAEKMRQEEEAERQKEEKANAKKEKERLANEKKKARRAAKKAEENGAA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.13
2 0.14
3 0.19
4 0.21
5 0.24
6 0.24
7 0.25
8 0.25
9 0.25
10 0.26
11 0.21
12 0.18
13 0.16
14 0.16
15 0.15
16 0.15
17 0.17
18 0.18
19 0.19
20 0.23
21 0.21
22 0.23
23 0.25
24 0.23
25 0.19
26 0.17
27 0.15
28 0.12
29 0.12
30 0.11
31 0.16
32 0.17
33 0.18
34 0.21
35 0.22
36 0.26
37 0.33
38 0.4
39 0.4
40 0.46
41 0.46
42 0.46
43 0.5
44 0.47
45 0.46
46 0.38
47 0.32
48 0.26
49 0.26
50 0.31
51 0.3
52 0.34
53 0.35
54 0.39
55 0.43
56 0.43
57 0.45
58 0.41
59 0.38
60 0.37
61 0.3
62 0.26
63 0.21
64 0.2
65 0.16
66 0.13
67 0.11
68 0.05
69 0.04
70 0.04
71 0.04
72 0.04
73 0.04
74 0.04
75 0.05
76 0.05
77 0.05
78 0.05
79 0.06
80 0.05
81 0.05
82 0.06
83 0.07
84 0.09
85 0.15
86 0.16
87 0.2
88 0.24
89 0.28
90 0.31
91 0.35
92 0.36
93 0.4
94 0.42
95 0.41
96 0.4
97 0.39
98 0.38
99 0.41
100 0.45
101 0.38
102 0.42
103 0.42
104 0.41
105 0.41
106 0.4
107 0.34
108 0.33
109 0.41
110 0.4
111 0.43
112 0.4
113 0.38
114 0.36
115 0.34
116 0.27
117 0.18
118 0.13
119 0.07
120 0.07
121 0.06
122 0.06
123 0.06
124 0.07
125 0.07
126 0.08
127 0.1
128 0.16
129 0.17
130 0.19
131 0.23
132 0.3
133 0.33
134 0.38
135 0.39
136 0.34
137 0.35
138 0.33
139 0.29
140 0.21
141 0.2
142 0.13
143 0.11
144 0.11
145 0.09
146 0.1
147 0.11
148 0.1
149 0.11
150 0.12
151 0.16
152 0.17
153 0.19
154 0.28
155 0.32
156 0.35
157 0.35
158 0.35
159 0.31
160 0.29
161 0.27
162 0.18
163 0.17
164 0.14
165 0.13
166 0.12
167 0.11
168 0.1
169 0.1
170 0.09
171 0.08
172 0.09
173 0.09
174 0.1
175 0.11
176 0.13
177 0.13
178 0.13
179 0.14
180 0.11
181 0.12
182 0.14
183 0.15
184 0.14
185 0.15
186 0.17
187 0.16
188 0.19
189 0.22
190 0.28
191 0.34
192 0.4
193 0.43
194 0.45
195 0.52
196 0.57
197 0.61
198 0.62
199 0.66
200 0.71
201 0.77
202 0.84
203 0.84
204 0.84
205 0.86
206 0.85
207 0.85
208 0.83
209 0.81
210 0.75
211 0.7
212 0.62
213 0.53
214 0.44
215 0.34
216 0.24
217 0.15
218 0.11
219 0.11
220 0.1
221 0.1
222 0.13
223 0.13
224 0.16
225 0.22
226 0.22
227 0.28
228 0.38
229 0.48
230 0.5
231 0.61
232 0.67
233 0.68
234 0.76
235 0.75
236 0.71
237 0.7
238 0.72
239 0.71
240 0.71
241 0.71
242 0.71
243 0.76
244 0.76
245 0.74
246 0.78
247 0.76
248 0.68
249 0.63
250 0.55
251 0.52
252 0.51
253 0.43
254 0.37
255 0.32
256 0.31
257 0.3
258 0.3
259 0.26
260 0.27
261 0.33
262 0.38
263 0.41
264 0.4
265 0.39
266 0.38
267 0.36
268 0.32
269 0.3
270 0.31
271 0.35
272 0.36
273 0.38
274 0.39
275 0.43
276 0.45
277 0.46
278 0.46
279 0.46
280 0.54
281 0.61
282 0.68
283 0.72
284 0.74
285 0.79
286 0.78
287 0.77
288 0.77
289 0.79
290 0.81
291 0.83
292 0.85
293 0.84
294 0.84
295 0.86
296 0.85
297 0.85
298 0.85
299 0.87
300 0.88
301 0.9
302 0.87