Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A4S4KXQ9

Protein Details
Accession A0A4S4KXQ9    Localization Confidence Medium Confidence Score 11
NoLS Segment(s)
PositionSequenceProtein Nature
42-68KVEAQEKKKQPKGRAKKRILYNRRFVNHydrophilic
NLS Segment(s)
PositionSequence
36-59VKSQTPKVEAQEKKKQPKGRAKKR
Subcellular Location(s) mito 13, nucl 9.5, cyto_nucl 6.5, cyto 2.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR006846  Ribosomal_S30  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF04758  Ribosomal_S30  
Amino Acid Sequences FGNSRAVFGLCCKSNISIVKNIMGKVHGSLARAGKVKSQTPKVEAQEKKKQPKGRAKKRILYNRRFVNVTTLQQGGKRKMNANPTN
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.27
2 0.32
3 0.32
4 0.32
5 0.32
6 0.36
7 0.36
8 0.36
9 0.31
10 0.26
11 0.23
12 0.17
13 0.2
14 0.16
15 0.15
16 0.18
17 0.19
18 0.21
19 0.23
20 0.22
21 0.22
22 0.24
23 0.27
24 0.3
25 0.34
26 0.33
27 0.35
28 0.4
29 0.39
30 0.45
31 0.45
32 0.47
33 0.51
34 0.57
35 0.63
36 0.64
37 0.67
38 0.67
39 0.74
40 0.77
41 0.78
42 0.81
43 0.81
44 0.82
45 0.86
46 0.88
47 0.87
48 0.84
49 0.82
50 0.79
51 0.74
52 0.68
53 0.58
54 0.55
55 0.5
56 0.44
57 0.38
58 0.32
59 0.3
60 0.33
61 0.39
62 0.37
63 0.39
64 0.41
65 0.43
66 0.47