Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A4S4K6C5

Protein Details
Accession A0A4S4K6C5    Localization Confidence Low Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
20-41PWKLSVTRKANQRKRLKRVDGVHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 21.5, cyto_mito 13, cyto 3.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR016340  Ribosomal_L31_mit  
Pfam View protein in Pfam  
PF09784  L31  
Amino Acid Sequences MFGPFRASHVSLSGLLWKTPWKLSVTRKANQRKRLKRVDGVIEAVRASGVECAALTKALELPKEHEMPARDKYTVFTPHARGYRKGVHKVPKFTRVAFFFFLASWRRTQCRFGWSPLPL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.21
2 0.19
3 0.19
4 0.21
5 0.21
6 0.22
7 0.24
8 0.21
9 0.27
10 0.36
11 0.46
12 0.49
13 0.52
14 0.6
15 0.68
16 0.73
17 0.76
18 0.79
19 0.79
20 0.82
21 0.86
22 0.83
23 0.79
24 0.76
25 0.73
26 0.65
27 0.58
28 0.5
29 0.4
30 0.32
31 0.26
32 0.19
33 0.12
34 0.09
35 0.05
36 0.04
37 0.04
38 0.03
39 0.04
40 0.04
41 0.05
42 0.04
43 0.04
44 0.07
45 0.08
46 0.09
47 0.09
48 0.12
49 0.15
50 0.17
51 0.17
52 0.17
53 0.18
54 0.21
55 0.26
56 0.25
57 0.22
58 0.21
59 0.22
60 0.24
61 0.27
62 0.26
63 0.26
64 0.27
65 0.32
66 0.38
67 0.4
68 0.37
69 0.38
70 0.44
71 0.47
72 0.51
73 0.53
74 0.57
75 0.61
76 0.69
77 0.69
78 0.69
79 0.65
80 0.6
81 0.6
82 0.53
83 0.51
84 0.43
85 0.38
86 0.3
87 0.26
88 0.28
89 0.25
90 0.23
91 0.23
92 0.26
93 0.3
94 0.32
95 0.37
96 0.38
97 0.43
98 0.46
99 0.48