FuNGI

A0A4V3XBT9

Protein Details

Accession

A0A4V3XBT9

Localization Confidence

Low

Confidence Score

5.9

NoLS Segment(s)

Position	Sequence	Protein Nature
11-32	LKFPCCERRLPRLSRYCWRTRI	Hydrophilic

NLS Segment(s)

Subcellular Location(s)

mito 11.5, cyto_mito 9, cyto 5.5, nucl 3, plas 2, pero 2, E.R. 2

Family & Domain DBs

InterPro	View protein in InterPro IPR018108 Mitochondrial_sb/sol_carrier IPR023395 Mt_carrier_dom_sf IPR044677 Pic2/Mir1-like IPR007128 PMF1/Nnf1
Gene Ontology	GO:0000444 C:MIS12/MIND type complex GO:0005743 C:mitochondrial inner membrane GO:0005634 C:nucleus GO:0005315 F:inorganic phosphate transmembrane transporter activity GO:0007049 P:cell cycle GO:0051301 P:cell division GO:1990547 P:mitochondrial phosphate ion transmembrane transport
Pfam	View protein in Pfam PF00153 Mito_carr PF03980 Nnf1
PROSITE	View protein in PROSITE PS50920 SOLCAR
CDD	cd14686 bZIP

Amino Acid Sequences

MALPPAHNQVLKFPCCERRLPRLSRYCWRTRISSPPLLVSMKSITVMKRNEDMLPLPVCGPIAGDPTGSSSGPFSSLGRASPAAGLGVPRSAGEVVDDGDEREPSGPDIAAGAMKYDAKAPPNLDLNLWGVPRARDASSSHTLTVVTAVCNVDCRVEQHKRVNTVQSDPESESTTGKQEVDTFSLCAAARDSACRAQVDEEPDGASGVYNTISLHMERLITGACNELFVRYNARENIDIMHAVVTEARERQKAGEPPGPDTWKANLEPRNAVRARTIPILRQEKATLEAQLAELERENMELQTQMMKNVNDLKANDAEETRRLNLLDELEAKWSSLPIEDIQEWTLRTAETLATKPTAYLDPKVPHDIPYYSKCMLGGVLACGITHAGITPLDVTKCNMQSYPLILYVEEFLATTDISYPSLHRSTRSSLTRVFFXGLSMIAREEGQKGLWKGVGPTFVGYSLQGMFKYGLYEVFKDLYSNVAGEENSKKYKSLIWLAGSASAEVFADIALCPLEMTKVKIQTSPAGTFPVPFGAALREMSKLKAETRYPFGSIVPLWSRQIPYTMAKFFFFEKIVSLFYTHVFTKPKNEYAKTTQLGVTFASGYLAGVVCAIVSHPADSLVSLMGKEANKGKGVGQIASEVGIANLATKGLGTRVIMIGTLTGFQWWIYDSFKSIMGMGTTGGK

FASTA Sequence
with NoLS information

AlphaFold Structure
with highlighted NoLS

NoLS Predictions per Residue

Residue Number	Score
1	0.47
2	0.49
3	0.57
4	0.55
5	0.58
6	0.65
7	0.69
8	0.74
9	0.75
10	0.79
11	0.81
12	0.82
13	0.8
14	0.79
15	0.75
16	0.71
17	0.67
18	0.7
19	0.68
20	0.68
21	0.6
22	0.55
23	0.55
24	0.51
25	0.45
26	0.37
27	0.31
28	0.24
29	0.24
30	0.23
31	0.21
32	0.27
33	0.31
34	0.31
35	0.33
36	0.35
37	0.34
38	0.35
39	0.34
40	0.32
41	0.3
42	0.27
43	0.23
44	0.22
45	0.2
46	0.16
47	0.16
48	0.12
49	0.13
50	0.13
51	0.12
52	0.12
53	0.15
54	0.18
55	0.16
56	0.15
57	0.13
58	0.13
59	0.14
60	0.15
61	0.12
62	0.15
63	0.16
64	0.16
65	0.19
66	0.19
67	0.18
68	0.18
69	0.17
70	0.13
71	0.12
72	0.13
73	0.1
74	0.1
75	0.1
76	0.09
77	0.1
78	0.1
79	0.09
80	0.09
81	0.09
82	0.09
83	0.11
84	0.11
85	0.11
86	0.12
87	0.12
88	0.11
89	0.12
90	0.11
91	0.1
92	0.12
93	0.1
94	0.09
95	0.1
96	0.1
97	0.1
98	0.09
99	0.09
100	0.08
101	0.09
102	0.09
103	0.12
104	0.14
105	0.15
106	0.19
107	0.2
108	0.24
109	0.28
110	0.29
111	0.26
112	0.25
113	0.25
114	0.25
115	0.24
116	0.2
117	0.17
118	0.17
119	0.19
120	0.2
121	0.18
122	0.17
123	0.19
124	0.25
125	0.3
126	0.32
127	0.29
128	0.27
129	0.26
130	0.23
131	0.24
132	0.17
133	0.11
134	0.12
135	0.12
136	0.11
137	0.13
138	0.13
139	0.12
140	0.12
141	0.15
142	0.21
143	0.28
144	0.35
145	0.43
146	0.48
147	0.52
148	0.56
149	0.6
150	0.54
151	0.52
152	0.51
153	0.44
154	0.42
155	0.38
156	0.35
157	0.31
158	0.29
159	0.26
160	0.21
161	0.21
162	0.19
163	0.18
164	0.17
165	0.16
166	0.17
167	0.19
168	0.18
169	0.16
170	0.14
171	0.17
172	0.16
173	0.14
174	0.13
175	0.12
176	0.12
177	0.13
178	0.16
179	0.16
180	0.18
181	0.18
182	0.18
183	0.18
184	0.21
185	0.24
186	0.22
187	0.2
188	0.18
189	0.18
190	0.17
191	0.14
192	0.11
193	0.06
194	0.05
195	0.05
196	0.05
197	0.05
198	0.06
199	0.07
200	0.07
201	0.08
202	0.08
203	0.08
204	0.08
205	0.09
206	0.08
207	0.07
208	0.07
209	0.09
210	0.08
211	0.09
212	0.09
213	0.09
214	0.1
215	0.11
216	0.15
217	0.14
218	0.19
219	0.2
220	0.22
221	0.21
222	0.21
223	0.22
224	0.18
225	0.17
226	0.13
227	0.11
228	0.09
229	0.08
230	0.08
231	0.07
232	0.08
233	0.1
234	0.12
235	0.13
236	0.13
237	0.16
238	0.22
239	0.26
240	0.3
241	0.32
242	0.31
243	0.35
244	0.4
245	0.4
246	0.34
247	0.31
248	0.27
249	0.26
250	0.26
251	0.28
252	0.28
253	0.28
254	0.33
255	0.33
256	0.39
257	0.36
258	0.36
259	0.32
260	0.29
261	0.29
262	0.3
263	0.29
264	0.24
265	0.32
266	0.37
267	0.35
268	0.34
269	0.32
270	0.27
271	0.29
272	0.27
273	0.19
274	0.13
275	0.13
276	0.12
277	0.12
278	0.11
279	0.08
280	0.07
281	0.07
282	0.07
283	0.07
284	0.07
285	0.06
286	0.06
287	0.06
288	0.06
289	0.11
290	0.11
291	0.12
292	0.14
293	0.14
294	0.16
295	0.21
296	0.22
297	0.2
298	0.2
299	0.21
300	0.2
301	0.21
302	0.2
303	0.15
304	0.15
305	0.15
306	0.16
307	0.15
308	0.13
309	0.13
310	0.13
311	0.14
312	0.13
313	0.12
314	0.12
315	0.12
316	0.13
317	0.12
318	0.12
319	0.1
320	0.09
321	0.08
322	0.06
323	0.07
324	0.06
325	0.08
326	0.08
327	0.09
328	0.1
329	0.11
330	0.1
331	0.1
332	0.09
333	0.07
334	0.07
335	0.07
336	0.07
337	0.08
338	0.09
339	0.1
340	0.1
341	0.1
342	0.1
343	0.11
344	0.13
345	0.12
346	0.14
347	0.18
348	0.19
349	0.22
350	0.26
351	0.25
352	0.24
353	0.25
354	0.25
355	0.23
356	0.24
357	0.27
358	0.23
359	0.23
360	0.21
361	0.18
362	0.17
363	0.13
364	0.1
365	0.06
366	0.06
367	0.06
368	0.06
369	0.06
370	0.05
371	0.04
372	0.04
373	0.03
374	0.03
375	0.03
376	0.04
377	0.05
378	0.06
379	0.07
380	0.07
381	0.08
382	0.12
383	0.13
384	0.14
385	0.13
386	0.14
387	0.14
388	0.16
389	0.17
390	0.15
391	0.13
392	0.12
393	0.12
394	0.12
395	0.11
396	0.09
397	0.06
398	0.05
399	0.05
400	0.05
401	0.05
402	0.05
403	0.06
404	0.06
405	0.07
406	0.07
407	0.11
408	0.15
409	0.16
410	0.16
411	0.19
412	0.23
413	0.3
414	0.33
415	0.32
416	0.34
417	0.35
418	0.35
419	0.32
420	0.29
421	0.21
422	0.17
423	0.16
424	0.11
425	0.1
426	0.09
427	0.09
428	0.08
429	0.09
430	0.1
431	0.09
432	0.09
433	0.13
434	0.13
435	0.14
436	0.15
437	0.14
438	0.15
439	0.17
440	0.18
441	0.14
442	0.14
443	0.13
444	0.12
445	0.12
446	0.1
447	0.09
448	0.09
449	0.09
450	0.08
451	0.09
452	0.09
453	0.09
454	0.1
455	0.09
456	0.11
457	0.12
458	0.13
459	0.14
460	0.14
461	0.14
462	0.13
463	0.13
464	0.12
465	0.1
466	0.09
467	0.09
468	0.09
469	0.09
470	0.11
471	0.15
472	0.18
473	0.21
474	0.22
475	0.21
476	0.21
477	0.25
478	0.28
479	0.3
480	0.31
481	0.3
482	0.31
483	0.31
484	0.34
485	0.3
486	0.24
487	0.17
488	0.12
489	0.1
490	0.07
491	0.07
492	0.04
493	0.04
494	0.04
495	0.04
496	0.04
497	0.04
498	0.04
499	0.04
500	0.07
501	0.07
502	0.12
503	0.16
504	0.21
505	0.22
506	0.25
507	0.27
508	0.3
509	0.34
510	0.33
511	0.29
512	0.28
513	0.27
514	0.25
515	0.24
516	0.19
517	0.15
518	0.12
519	0.12
520	0.1
521	0.11
522	0.12
523	0.12
524	0.14
525	0.14
526	0.16
527	0.18
528	0.18
529	0.21
530	0.26
531	0.3
532	0.31
533	0.37
534	0.39
535	0.37
536	0.36
537	0.33
538	0.3
539	0.25
540	0.27
541	0.23
542	0.23
543	0.23
544	0.24
545	0.26
546	0.23
547	0.26
548	0.23
549	0.25
550	0.29
551	0.32
552	0.3
553	0.3
554	0.3
555	0.3
556	0.29
557	0.25
558	0.2
559	0.17
560	0.17
561	0.18
562	0.17
563	0.17
564	0.14
565	0.14
566	0.17
567	0.16
568	0.19
569	0.22
570	0.22
571	0.3
572	0.35
573	0.42
574	0.47
575	0.49
576	0.52
577	0.56
578	0.64
579	0.56
580	0.53
581	0.48
582	0.41
583	0.39
584	0.32
585	0.26
586	0.17
587	0.15
588	0.13
589	0.1
590	0.08
591	0.09
592	0.08
593	0.06
594	0.06
595	0.05
596	0.05
597	0.05
598	0.05
599	0.06
600	0.07
601	0.07
602	0.08
603	0.09
604	0.09
605	0.09
606	0.1
607	0.08
608	0.09
609	0.08
610	0.09
611	0.13
612	0.13
613	0.17
614	0.21
615	0.23
616	0.24
617	0.26
618	0.26
619	0.28
620	0.3
621	0.28
622	0.23
623	0.22
624	0.2
625	0.2
626	0.19
627	0.12
628	0.09
629	0.09
630	0.07
631	0.07
632	0.06
633	0.06
634	0.05
635	0.05
636	0.06
637	0.07
638	0.1
639	0.09
640	0.12
641	0.13
642	0.13
643	0.13
644	0.13
645	0.13
646	0.11
647	0.11
648	0.08
649	0.08
650	0.08
651	0.07
652	0.08
653	0.09
654	0.1
655	0.12
656	0.13
657	0.16
658	0.17
659	0.19
660	0.19
661	0.18
662	0.18
663	0.16
664	0.15

A0A4V3XBT9

3D AlphaFold-predicted Structure Viewer