Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A4S4L0C6

Protein Details
Accession A0A4S4L0C6    Localization Confidence Medium Confidence Score 12.5
NoLS Segment(s)
PositionSequenceProtein Nature
27-47DESTSASRKKRKKILHAIPVVHydrophilic
NLS Segment(s)
PositionSequence
34-39RKKRKK
Subcellular Location(s) nucl 15.5, mito 10, cyto_nucl 9
Family & Domain DBs
Amino Acid Sequences MPILRRRLRINPQLPPGLAGDGLSRPDESTSASRKKRKKILHAIPVVLRELLRTLKESSDFCPPLKSAIGGLSHIIETVETMKGNKDDAFRLFHKVEDLLNLLADLIPDCENVPPQIVLAVSRLDE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.64
2 0.56
3 0.48
4 0.38
5 0.3
6 0.22
7 0.17
8 0.12
9 0.14
10 0.13
11 0.12
12 0.11
13 0.12
14 0.12
15 0.13
16 0.17
17 0.24
18 0.32
19 0.4
20 0.48
21 0.55
22 0.64
23 0.7
24 0.73
25 0.76
26 0.78
27 0.8
28 0.82
29 0.79
30 0.73
31 0.66
32 0.58
33 0.48
34 0.37
35 0.27
36 0.17
37 0.14
38 0.12
39 0.11
40 0.11
41 0.12
42 0.13
43 0.15
44 0.16
45 0.16
46 0.23
47 0.23
48 0.21
49 0.22
50 0.21
51 0.2
52 0.19
53 0.18
54 0.1
55 0.11
56 0.12
57 0.1
58 0.11
59 0.09
60 0.09
61 0.09
62 0.08
63 0.05
64 0.05
65 0.06
66 0.06
67 0.06
68 0.06
69 0.08
70 0.09
71 0.1
72 0.12
73 0.13
74 0.15
75 0.17
76 0.22
77 0.22
78 0.28
79 0.27
80 0.25
81 0.25
82 0.23
83 0.21
84 0.18
85 0.19
86 0.13
87 0.13
88 0.12
89 0.11
90 0.1
91 0.09
92 0.07
93 0.07
94 0.07
95 0.07
96 0.08
97 0.09
98 0.11
99 0.11
100 0.13
101 0.11
102 0.11
103 0.12
104 0.12
105 0.12
106 0.12