Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A4S4L0S4

Protein Details
Accession A0A4S4L0S4    Localization Confidence Medium Confidence Score 12.2
NoLS Segment(s)
PositionSequenceProtein Nature
26-50ASSPSTARRIRKKRSAARKGWKGWVHydrophilic
NLS Segment(s)
PositionSequence
32-47ARRIRKKRSAARKGWK
Subcellular Location(s) nucl 15.5, cyto_nucl 10.833, mito_nucl 10.833
Family & Domain DBs
Amino Acid Sequences MSYGSSKRPHTPEDGFSLLDEPIMRASSPSTARRIRKKRSAARKGWKGWVEGSPPPSDKLINLDSAPVMVERRTRSGKNFDAISEGTDTWVSPGMSNSHSTP
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.47
2 0.39
3 0.35
4 0.32
5 0.25
6 0.2
7 0.16
8 0.1
9 0.09
10 0.1
11 0.09
12 0.08
13 0.09
14 0.13
15 0.18
16 0.2
17 0.26
18 0.33
19 0.4
20 0.51
21 0.59
22 0.63
23 0.68
24 0.75
25 0.79
26 0.82
27 0.85
28 0.85
29 0.86
30 0.86
31 0.8
32 0.77
33 0.7
34 0.6
35 0.52
36 0.45
37 0.38
38 0.31
39 0.29
40 0.24
41 0.22
42 0.22
43 0.21
44 0.17
45 0.14
46 0.16
47 0.15
48 0.14
49 0.14
50 0.13
51 0.12
52 0.12
53 0.12
54 0.08
55 0.08
56 0.07
57 0.11
58 0.13
59 0.18
60 0.23
61 0.26
62 0.3
63 0.38
64 0.41
65 0.42
66 0.41
67 0.36
68 0.35
69 0.33
70 0.3
71 0.24
72 0.2
73 0.16
74 0.15
75 0.15
76 0.12
77 0.15
78 0.13
79 0.11
80 0.13
81 0.15
82 0.17