Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A4S4KGF6

Protein Details
Accession A0A4S4KGF6   
Localization Confidence Low
Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
5-29RLYSKGRVLSHKRGKRNTRPNTSLVHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 13, mito_nucl 11.833, mito 9.5, cyto_nucl 9.333
Family & Domain DBs
InterPro View protein in InterPro  
IPR038661  L35A_sf  
IPR001780  Ribosomal_L35A  
IPR009000  Transl_B-barrel_sf  
Gene Ontology GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF01247  Ribosomal_L35Ae  
Amino Acid Sequences MGSTRLYSKGRVLSHKRGKRNTRPNTSLVQIEGVATKEEAQFYLGKRVAYVYRAKREVNGSKVRVIWGRVTRSHGNSGVVKSKFRSNLPPHVFGASVRVMLYPSTI
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.65
2 0.72
3 0.76
4 0.79
5 0.84
6 0.85
7 0.88
8 0.87
9 0.86
10 0.83
11 0.77
12 0.71
13 0.63
14 0.54
15 0.44
16 0.34
17 0.24
18 0.2
19 0.17
20 0.13
21 0.11
22 0.09
23 0.09
24 0.09
25 0.09
26 0.08
27 0.09
28 0.1
29 0.11
30 0.18
31 0.18
32 0.18
33 0.17
34 0.19
35 0.18
36 0.19
37 0.26
38 0.24
39 0.28
40 0.31
41 0.31
42 0.32
43 0.38
44 0.4
45 0.4
46 0.41
47 0.38
48 0.37
49 0.38
50 0.38
51 0.33
52 0.29
53 0.28
54 0.27
55 0.29
56 0.29
57 0.35
58 0.37
59 0.38
60 0.41
61 0.36
62 0.34
63 0.33
64 0.34
65 0.36
66 0.33
67 0.32
68 0.29
69 0.34
70 0.35
71 0.35
72 0.42
73 0.41
74 0.5
75 0.55
76 0.57
77 0.52
78 0.49
79 0.47
80 0.37
81 0.35
82 0.25
83 0.2
84 0.16
85 0.15
86 0.13