Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A4S4LI52

Protein Details
Accession A0A4S4LI52    Localization Confidence Medium Confidence Score 12.7
NoLS Segment(s)
PositionSequenceProtein Nature
33-64LTPKRGKSVRNPRVKKRQKFEKAKRKLSSQKABasic
NLS Segment(s)
PositionSequence
33-60LTPKRGKSVRNPRVKKRQKFEKAKRKLS
Subcellular Location(s) nucl 18, cyto_nucl 14, cyto 6
Family & Domain DBs
InterPro View protein in InterPro  
IPR007146  Sas10/Utp3/C1D  
IPR018972  Sas10_C_dom  
Pfam View protein in Pfam  
PF09368  Sas10  
Amino Acid Sequences MSSLVNIYSIDFDDDSASGQRSITRAILANKGLTPKRGKSVRNPRVKKRQKFEKAKRKLSSQKAVYKGGISETGRYDGEKSGISKVVKSIKM
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.11
2 0.12
3 0.12
4 0.13
5 0.11
6 0.11
7 0.12
8 0.12
9 0.14
10 0.13
11 0.13
12 0.15
13 0.18
14 0.22
15 0.21
16 0.21
17 0.21
18 0.26
19 0.25
20 0.26
21 0.28
22 0.26
23 0.33
24 0.37
25 0.39
26 0.44
27 0.54
28 0.59
29 0.66
30 0.7
31 0.71
32 0.77
33 0.85
34 0.82
35 0.8
36 0.82
37 0.82
38 0.86
39 0.88
40 0.88
41 0.88
42 0.89
43 0.84
44 0.82
45 0.81
46 0.79
47 0.77
48 0.74
49 0.72
50 0.67
51 0.67
52 0.58
53 0.5
54 0.41
55 0.33
56 0.31
57 0.24
58 0.22
59 0.2
60 0.22
61 0.21
62 0.22
63 0.22
64 0.17
65 0.18
66 0.19
67 0.18
68 0.19
69 0.25
70 0.25
71 0.25
72 0.29