Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A4S4LB46

Protein Details
Accession A0A4S4LB46    Localization Confidence Medium Confidence Score 13.1
NoLS Segment(s)
PositionSequenceProtein Nature
1-36MPKDPSTKKTRKAPTERAAPRAKSKKDPNAPKRALSHydrophilic
NLS Segment(s)
PositionSequence
8-33KKTRKAPTERAAPRAKSKKDPNAPKR
Subcellular Location(s) nucl 19.5, cyto_nucl 13, cyto 5.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR009071  HMG_box_dom  
IPR036910  HMG_box_dom_sf  
Gene Ontology GO:0005634  C:nucleus  
GO:0003677  F:DNA binding  
Pfam View protein in Pfam  
PF00505  HMG_box  
PROSITE View protein in PROSITE  
PS50118  HMG_BOX_2  
CDD cd01390  HMG-box_NHP6-like  
Amino Acid Sequences MPKDPSTKKTRKAPTERAAPRAKSKKDPNAPKRALSAYMFFSQDWRERIKVENPDAGFGEVGKLLGAKWKELDEAEKKPYKDLAAHDRTRAEQEKAEYDGKASGGGGDDEDDD
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.84
2 0.85
3 0.82
4 0.81
5 0.78
6 0.72
7 0.72
8 0.72
9 0.68
10 0.67
11 0.71
12 0.73
13 0.76
14 0.82
15 0.81
16 0.83
17 0.81
18 0.73
19 0.68
20 0.59
21 0.52
22 0.43
23 0.36
24 0.28
25 0.27
26 0.25
27 0.21
28 0.2
29 0.2
30 0.22
31 0.21
32 0.21
33 0.19
34 0.19
35 0.23
36 0.28
37 0.31
38 0.3
39 0.33
40 0.3
41 0.3
42 0.29
43 0.26
44 0.2
45 0.13
46 0.11
47 0.06
48 0.06
49 0.04
50 0.04
51 0.03
52 0.08
53 0.08
54 0.08
55 0.09
56 0.1
57 0.11
58 0.12
59 0.18
60 0.19
61 0.23
62 0.29
63 0.33
64 0.33
65 0.33
66 0.35
67 0.31
68 0.3
69 0.31
70 0.35
71 0.39
72 0.41
73 0.43
74 0.43
75 0.42
76 0.46
77 0.44
78 0.36
79 0.31
80 0.33
81 0.34
82 0.36
83 0.37
84 0.3
85 0.27
86 0.26
87 0.22
88 0.19
89 0.15
90 0.11
91 0.1
92 0.11
93 0.1