Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A4S4KVP8

Protein Details
Accession A0A4S4KVP8   
Localization Confidence High
Confidence Score 21.4
NoLS Segment(s)
PositionSequenceProtein Nature
32-57PEPTTPVKRGRGRPKGSKNKKATDAPBasic
86-110AEGDQKPKRPRGRPPKNAKPKDGEDBasic
120-143DVDGGPPKKKRGRQTKAIMTARKDBasic
NLS Segment(s)
PositionSequence
39-106KRGRGRPKGSKNKKATDAPSSSAAAAPSGPSSAGSGGKKRGRPRKIVAEGDQKPKRPRGRPPKNAKPK
126-135PKKKRGRQTK
Subcellular Location(s) nucl 24.5, cyto_nucl 13.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR017956  AT_hook_DNA-bd_motif  
IPR000116  HMGA  
Gene Ontology GO:0000785  C:chromatin  
GO:0005634  C:nucleus  
GO:0003677  F:DNA binding  
GO:0006355  P:regulation of DNA-templated transcription  
Pfam View protein in Pfam  
PF02178  AT_hook  
Amino Acid Sequences MSASPTANEAAVEKIISEPAEDVHAEGDELGPEPTTPVKRGRGRPKGSKNKKATDAPSSSAAAAPSGPSSAGSGGKKRGRPRKIVAEGDQKPKRPRGRPPKNAKPKDGEDDDDNDNDEDDVDGGPPKKKRGRQTKAIMTARKD
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.1
2 0.11
3 0.11
4 0.1
5 0.09
6 0.08
7 0.11
8 0.1
9 0.1
10 0.09
11 0.09
12 0.08
13 0.08
14 0.07
15 0.06
16 0.06
17 0.06
18 0.06
19 0.05
20 0.07
21 0.11
22 0.13
23 0.15
24 0.19
25 0.28
26 0.36
27 0.46
28 0.55
29 0.62
30 0.68
31 0.76
32 0.82
33 0.84
34 0.87
35 0.88
36 0.85
37 0.81
38 0.8
39 0.76
40 0.69
41 0.66
42 0.58
43 0.5
44 0.45
45 0.39
46 0.32
47 0.26
48 0.22
49 0.14
50 0.11
51 0.09
52 0.06
53 0.05
54 0.05
55 0.04
56 0.05
57 0.06
58 0.09
59 0.1
60 0.11
61 0.18
62 0.23
63 0.27
64 0.35
65 0.44
66 0.46
67 0.52
68 0.56
69 0.61
70 0.64
71 0.65
72 0.62
73 0.63
74 0.63
75 0.66
76 0.64
77 0.59
78 0.56
79 0.59
80 0.61
81 0.58
82 0.63
83 0.65
84 0.72
85 0.77
86 0.83
87 0.86
88 0.89
89 0.9
90 0.85
91 0.81
92 0.75
93 0.72
94 0.65
95 0.58
96 0.49
97 0.46
98 0.43
99 0.36
100 0.32
101 0.24
102 0.2
103 0.16
104 0.14
105 0.1
106 0.08
107 0.07
108 0.06
109 0.1
110 0.12
111 0.18
112 0.21
113 0.29
114 0.38
115 0.45
116 0.55
117 0.63
118 0.7
119 0.75
120 0.82
121 0.84
122 0.86
123 0.88