Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A4S4KR60

Protein Details
Accession A0A4S4KR60   
Localization Confidence Medium
Confidence Score 14.3
NoLS Segment(s)
PositionSequenceProtein Nature
182-213APSELGENKKKNKNKNKNKDRHKDKDNASGRSBasic
NLS Segment(s)
PositionSequence
189-206NKKKNKNKNKNKDRHKDK
Subcellular Location(s) nucl 17, cyto 6, mito 2, pero 2
Family & Domain DBs
Amino Acid Sequences MPTPTPVSTAASVDAGVKPFSIDLKCLHMHLAVRVAEVLACAEAMWEWVASEQERYTIEQEEERSRGEFRGRRAIQKPKDVVMSAIRKMSRSDFDSCLSRFEMDMHDNIALDYALEKYLNLRPGLAPGRSAERKSFDAACATWDSGYFSDSELDGTLLNSTGSDPTASVPIKVASTNGRSAAPSELGENKKKNKNKNKNKDRHKDKDNASGRSAASDVVTPRQLCRSFRIFAAWKEG
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.17
2 0.15
3 0.14
4 0.12
5 0.11
6 0.12
7 0.16
8 0.15
9 0.15
10 0.15
11 0.21
12 0.22
13 0.22
14 0.23
15 0.21
16 0.22
17 0.22
18 0.26
19 0.21
20 0.2
21 0.2
22 0.18
23 0.15
24 0.14
25 0.12
26 0.06
27 0.05
28 0.04
29 0.04
30 0.04
31 0.05
32 0.05
33 0.05
34 0.05
35 0.05
36 0.07
37 0.07
38 0.09
39 0.09
40 0.1
41 0.12
42 0.14
43 0.15
44 0.16
45 0.17
46 0.18
47 0.22
48 0.24
49 0.24
50 0.23
51 0.23
52 0.21
53 0.22
54 0.28
55 0.28
56 0.28
57 0.38
58 0.39
59 0.45
60 0.52
61 0.6
62 0.58
63 0.63
64 0.62
65 0.53
66 0.54
67 0.46
68 0.41
69 0.38
70 0.36
71 0.29
72 0.3
73 0.28
74 0.26
75 0.27
76 0.28
77 0.24
78 0.23
79 0.26
80 0.24
81 0.25
82 0.29
83 0.28
84 0.27
85 0.24
86 0.2
87 0.16
88 0.15
89 0.16
90 0.13
91 0.13
92 0.12
93 0.11
94 0.11
95 0.1
96 0.09
97 0.06
98 0.05
99 0.05
100 0.04
101 0.04
102 0.04
103 0.04
104 0.06
105 0.09
106 0.12
107 0.11
108 0.11
109 0.11
110 0.15
111 0.18
112 0.16
113 0.15
114 0.13
115 0.19
116 0.21
117 0.22
118 0.2
119 0.21
120 0.22
121 0.24
122 0.25
123 0.19
124 0.19
125 0.18
126 0.18
127 0.15
128 0.14
129 0.12
130 0.11
131 0.12
132 0.1
133 0.1
134 0.08
135 0.07
136 0.08
137 0.08
138 0.08
139 0.06
140 0.06
141 0.06
142 0.06
143 0.06
144 0.05
145 0.05
146 0.05
147 0.05
148 0.05
149 0.05
150 0.05
151 0.05
152 0.06
153 0.11
154 0.11
155 0.11
156 0.12
157 0.12
158 0.13
159 0.13
160 0.14
161 0.13
162 0.16
163 0.18
164 0.19
165 0.19
166 0.18
167 0.19
168 0.2
169 0.17
170 0.15
171 0.15
172 0.21
173 0.26
174 0.32
175 0.37
176 0.43
177 0.51
178 0.58
179 0.66
180 0.7
181 0.77
182 0.82
183 0.87
184 0.9
185 0.91
186 0.95
187 0.96
188 0.95
189 0.94
190 0.91
191 0.89
192 0.83
193 0.83
194 0.81
195 0.74
196 0.66
197 0.6
198 0.52
199 0.45
200 0.39
201 0.29
202 0.21
203 0.19
204 0.19
205 0.19
206 0.24
207 0.22
208 0.24
209 0.32
210 0.36
211 0.35
212 0.4
213 0.41
214 0.38
215 0.39
216 0.46
217 0.43